DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Nodal

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_038639.2 Gene:Nodal / 18119 MGIID:97359 Length:354 Species:Mus musculus


Alignment Length:238 Identity:63/238 - (26%)
Similarity:95/238 - (39%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 DVTKAVRSWLNKSHENLGIEI--QCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIG 547
            :|||.:..|| |....|..::  :.:||.         ..|.|||...||::       ||.:..
Mouse   155 EVTKPLSKWL-KDPRALEKQVSSRAEKCW---------HQPYTPPVPVASTN-------VLMLYS 202

  Fly   548 HGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDK---------WTNNCYKLH----- 598
            :.....:|.|.|.:                ....:|:||..:         |.....:.|     
Mouse   203 NRPQEQRQLGGATL----------------LWEAESSWRAQEGQLSVERGGWGRRQRRHHLPDRS 251

  Fly   599 QRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPA----H--HHALLQSLIWQEDHK 657
            |.|.|.:..|.|..|....:|:.||.::|..|.|.||   ||.    |  :||.:|||:.:....
Mouse   252 QLCRRVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECP---NPVGEEFHPTNHAYIQSLLKRYQPH 313

  Fly   658 RAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            |.|..||.|.|.:.|.:|:||   :.::.:....||.|.||.|
Mouse   314 RVPSTCCAPVKTKPLSMLYVD---NGRVLLEHHKDMIVEECGC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 7/22 (32%)
TGF_beta 599..700 CDD:278448 37/106 (35%)
NodalNP_038639.2 TGFb_propeptide 33..169 CDD:279078 6/14 (43%)
TGFB 254..353 CDD:214556 36/104 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850417
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.