DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and dbl-1

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_504709.1 Gene:dbl-1 / 179068 WormBaseID:WBGene00000936 Length:365 Species:Caenorhabditis elegans


Alignment Length:360 Identity:87/360 - (24%)
Similarity:139/360 - (38%) Gaps:115/360 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 QDTMNILLHFPLTNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIE 425
            :|....||.:.|:.|. .|.|::::.:|.::|.|                |:|..::.|||.:| 
 Worm   100 EDNEGFLLSYNLSLAA-RNAHNEEVTKATLKLRL----------------RRNNKARRSGNISI- 146

  Fly   426 RHCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAV 490
               .|.:.::|                    |.|.:|.||.:        :..|:||:||||.|.
 Worm   147 ---YFFEDDIN--------------------NDRFQIESRSV--------DNLTEWIDFDVTAAF 180

  Fly   491 RSWLNKSH------ENLGIE---------IQCDKCKSIGARILSDFS-PSTPPRSTASSDEHLNL 539
            ....|:..      |::.||         :...:.:|....:.||.| ||:..|.          
 Worm   181 LRRTNRISFFIDLPEDVEIEETQSSSLSSLPYARAQSAPLIVFSDLSEPSSVRRK---------- 235

  Fly   540 MPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRN 604
                        .|.|.|:::      ..||.....||.:..:|               ..|.|.
 Worm   236 ------------RSAQTGNSE------RKNRKKGRKHHNTEAES---------------NLCRRT 267

  Fly   605 QLDVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLIWQEDHKRAPRPCCTP 666
            ...|.|..:...::|:.||.:||..|.|.||   |....|.:||::|||:........|.|||.|
 Worm   268 DFYVDFDDLNWQDWIMAPKGYDAYQCQGSCPNPMPAQLNATNHAIIQSLLHSLRPDEVPPPCCVP 332

  Fly   667 SKLEMLEILHVDENHSDK-LKISTWSDMQVVECAC 700
            ::...|.||::|   .|| :.|..::||:|..|.|
 Worm   333 TETSPLSILYMD---VDKVIVIREYADMRVESCGC 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 17/78 (22%)
TGF_beta 599..700 CDD:278448 36/104 (35%)
dbl-1NP_504709.1 TGFb_propeptide <120..>182 CDD:366248 24/109 (22%)
TGF_beta_BMP5_like 264..365 CDD:381639 37/104 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.