DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and dbl-1

DIOPT Version :10

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_504709.1 Gene:dbl-1 / 179068 WormBaseID:WBGene00000936 Length:365 Species:Caenorhabditis elegans


Alignment Length:47 Identity:9/47 - (19%)
Similarity:24/47 - (51%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 CLIDTNNIKK--LEGIYGYLMIIVPFVIGGFFAVMVETLIAKDKMLD 159
            |.:::::::.  ||.:...:..:....:|....|.|:.::|..|.|:
 Worm   241 CKLESDSMRSRYLECLCSLMQELRSTPVGQLSKVKVKEMLAVLKDLE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <438..518 CDD:480997
TGF_beta_maverick 598..700 CDD:381633
dbl-1NP_504709.1 TGFb_propeptide <90..>182 CDD:480997
TGF_beta_BMP5_like 264..365 CDD:381639 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.