DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and tig-2

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_504271.1 Gene:tig-2 / 178864 WormBaseID:WBGene00006570 Length:366 Species:Caenorhabditis elegans


Alignment Length:378 Identity:81/378 - (21%)
Similarity:138/378 - (36%) Gaps:95/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PLTNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNK---------ISQISGNDNIER 426
            |||....     |||.|   ::..|::..:..|   ||..:.|.         ..|:...::.|.
 Worm    35 PLTGQAT-----DKIGE---QIRELFNIDINPN---GPAVKANNYVSTYMKRLYKQLENYEHGEN 88

  Fly   427 HCNFGDVNLNQSNKNSSQQLTLKVYQLLSANR----RRKITSRKIEFGNVGFQETRTQWIEFDVT 487
            |        |:...|:          .|||:|    ..:..|.:::.|:...:..:......:..
 Worm    89 H--------NEEEVNA----------WLSADRIVSHMAQEVSHRLDDGSYSIRFAKEHVPAKEGQ 135

  Fly   488 KAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRST--ASSDE--------------- 535
            ..||:       .|.|.||     .|.:.:......:..|..|  .|||:               
 Worm   136 SIVRA-------QLRIHIQ-----GIVSPVFFYIEDTNLPGDTVLVSSDDPTVVTDVTTMVDRWS 188

  Fly   536 HLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDST-------WRKDKWTNN 593
            ||.|..:..:....:.|.:...:|.:...:...:........|.:..:|       .:|.|.:.:
 Worm   189 HLQLSTLPIVTARASTNDELKIEAFLVIALKDEDAGPPKKRSRRSASTTPISAPPMRQKVKRSES 253

  Fly   594 CY----KLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLI 651
            .|    ..::||.|..|.|.|..:...::::.|:.|.|.||.|.|.   .:...|..||::||.:
 Worm   254 AYFEKPNENERCQRKGLYVDFDILGWKQWVIAPEGFSAFYCSGDCSAPFSKEMNATSHAIVQSTL 318

  Fly   652 WQEDHKRAPRPC----CTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
                |:..|...    |.||.|...:||.||:|  .:::|..:.||.|.||.|
 Worm   319 ----HRVRPNSTTPAKCAPSSLGSYKILFVDQN--KQVQIKRYRDMVVDECGC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 10/67 (15%)
TGF_beta 599..700 CDD:278448 35/107 (33%)
tig-2NP_504271.1 TGF_beta_BMP5_like 264..366 CDD:381639 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.