DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and daf-7

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_497265.1 Gene:daf-7 / 175237 WormBaseID:WBGene00000903 Length:350 Species:Caenorhabditis elegans


Alignment Length:434 Identity:88/434 - (20%)
Similarity:153/434 - (35%) Gaps:121/434 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 FMGASFTRDLHFLS----ITTNGFND--ISNKRLRHRRSLKKINRLNQNPKKH------------ 350
            ||.:|....:..||    :|.|..|.  ...|..:||....|...|:|...|.            
 Worm     2 FMASSLPVFIFLLSLPHGLTFNCTNSGVCIEKMKQHRTEYLKNEILDQLNMKEAPKGLKPMDPEM 66

  Fly   351 -----QNYGDLLRGEQDTMNILLHFPLTNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGS 410
                 :.|.|||..::..|.:.:.|  ..|:|.::..:             .|.|...|......
 Worm    67 KSVYLEMYRDLLEKDEQDMGVEMSF--YTAKDPSYGEN-------------PSQLVAKFDVTNDL 116

  Fly   411 RKNKISQISGNDNIERHCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQ 475
            .::.|.|.:...:||         :...:....|.:.::||:             |.|.|::|..
 Worm   117 ERSDILQATLTVSIE---------IPAKDSGMLQDVQVQVYE-------------KNEDGSMGEM 159

  Fly   476 ETRTQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLM 540
                      ||..:  :..|..|.:.|::..|..||                       ...:.
 Worm   160 ----------VTSGI--FATKGSERISIQLPIDTVKS-----------------------WFTIS 189

  Fly   541 PVLNIIGHGTLNSQ------QHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQ 599
            |:..|.....|:.:      |...||:..:.|..:...:....|.:|      .|...|.....:
 Worm   190 PIQGIFVKAMLDGRNVALHPQQTTADVDNMRLQLSTRPKGSRKRRSH------AKPVCNAEAQSK 248

  Fly   600 RCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQ---SLIWQEDHKRAPR 661
            .||...|::.|:.| |:::|:.|..::|..|.|.|   |..|||..|.:   |.|.:..|| ...
 Worm   249 GCCLYDLEIEFEKI-GWDWIVAPPRYNAYMCRGDC---HYNAHHFNLAETGHSKIMRAAHK-VSN 308

  Fly   662 P----CCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            |    ||.|::.:.:::::|  |...::.|:..:.|...:|.||
 Worm   309 PEIGYCCHPTEYDYIKLIYV--NRDGRVSIANVNGMIAKKCGCS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 12/63 (19%)
TGF_beta 599..700 CDD:278448 30/107 (28%)
daf-7NP_497265.1 TGFB 250..350 CDD:214556 30/106 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.