DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Inhbe

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_032408.2 Gene:Inhbe / 16326 MGIID:109269 Length:350 Species:Mus musculus


Alignment Length:129 Identity:39/129 - (30%)
Similarity:60/129 - (46%) Gaps:7/129 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   578 RSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPR--HNP 640
            |:|.....|..:.|..|......|||....|.|:.:...::||||:.:...||.|:|||.  .:|
Mouse   224 RANEPGAGRARRRTPTCEPETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSP 288

  Fly   641 ---AHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
               |..|:.:.||:...:...|...||.|:....|.:|::|  |:..:..:...||.|..|.||
Mouse   289 GIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLD--HNGNVVKTDVPDMVVEACGCS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078
TGF_beta 599..700 CDD:278448 32/105 (30%)
InhbeNP_032408.2 TGF_beta 246..349 CDD:278448 32/104 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.