DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Inhbe

DIOPT Version :10

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_032408.2 Gene:Inhbe / 16326 MGIID:109269 Length:350 Species:Mus musculus


Alignment Length:129 Identity:39/129 - (30%)
Similarity:60/129 - (46%) Gaps:7/129 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   578 RSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPR--HNP 640
            |:|.....|..:.|..|......|||....|.|:.:...::||||:.:...||.|:|||.  .:|
Mouse   224 RANEPGAGRARRRTPTCEPETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSP 288

  Fly   641 ---AHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
               |..|:.:.||:...:...|...||.|:....|.:|::|  |:..:..:...||.|..|.||
Mouse   289 GIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLD--HNGNVVKTDVPDMVVEACGCS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <438..518 CDD:480997
TGF_beta_maverick 598..700 CDD:381633 32/106 (30%)
InhbeNP_032408.2 TGF_beta_INHBC_E 247..350 CDD:381676 32/104 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.