DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Inhbc

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_034695.1 Gene:Inhbc / 16325 MGIID:105932 Length:352 Species:Mus musculus


Alignment Length:116 Identity:34/116 - (29%)
Similarity:54/116 - (46%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 NCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP------PRHNPAHHHALLQSLI 651
            :|....:.|||.:..|.|:.|...::|:||:.:...:|.|:||      |..:.:.|.|:|..|.
Mouse   239 DCQGASRMCCRQEFFVDFREIGWNDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLK 303

  Fly   652 WQEDHKRAPR-PCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            .........| .||.|:....|.:|:.|.: |:.:|... .||.|..|.||
Mouse   304 ANAAAGTTGRGSCCVPTSRRPLSLLYYDRD-SNIVKTDI-PDMVVEACGCS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078
TGF_beta 599..700 CDD:278448 31/107 (29%)
InhbcNP_034695.1 TGFB 247..352 CDD:214556 31/106 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.