DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and GDF7

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_878248.2 Gene:GDF7 / 151449 HGNCID:4222 Length:450 Species:Homo sapiens


Alignment Length:104 Identity:34/104 - (32%)
Similarity:55/104 - (52%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 RCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRC--PPR-HNPAHHHALLQSLIWQEDHKRAPR 661
            ||.|..|.|.||.:...::|:.|..::|.:|.|.|  |.| |....:||::|:|:.......||.
Human   348 RCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPA 412

  Fly   662 PCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            .||.|::|..:.||::|.  ::.:....:.||.|..|.|
Human   413 SCCVPARLSPISILYIDA--ANNVVYKQYEDMVVEACGC 449

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078
TGF_beta 599..700 CDD:278448 33/102 (32%)
GDF7NP_878248.2 TGFb_propeptide <91..>217 CDD:279078