DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf9

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_032136.2 Gene:Gdf9 / 14566 MGIID:95692 Length:441 Species:Mus musculus


Alignment Length:325 Identity:66/325 - (20%)
Similarity:108/325 - (33%) Gaps:105/325 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 LNQSNKNSSQ---QLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNK 496
            ||.|..:||.   ...|.|.:.:|:.|......       ..|...:.:|||.|||..::..:..
Mouse   162 LNNSASSSSTVTCMCDLVVKEAMSSGRAPPRAP-------YSFTLKKHRWIEIDVTSLLQPLVTS 219

  Fly   497 SHE--NLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDA 559
            |..  :|.:...|.|     .::..|...|.|          |::.|.|                
Mouse   220 SERSIHLSVNFTCTK-----DQVPEDGVFSMP----------LSVPPSL---------------- 253

  Fly   560 DIHQIMLTNNRSDQYVHHRSNHDSTWR-------------------------------------- 586
                |:..|:.|.|..|...:..||||                                      
Mouse   254 ----ILYLNDTSTQAYHSWQSLQSTWRPLQHPGQAGVAARPVKEEAIEVERSPRRRRGQKAIRSE 314

  Fly   587 -KDKWTNNCYKLHQ----------RCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP--PRH 638
             |.......:.|.:          .|..:...::|..:|...:|:.|..::..||.|.||  .||
Mouse   315 AKGPLLTASFNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRH 379

  Fly   639 ---NPAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
               :|.  |.::|::|:::.....|||.|.|.|...|.:|.::.:.|  :....:.||....|.|
Mouse   380 RYGSPV--HTMVQNIIYEKLDPSVPRPSCVPGKYSPLSVLTIEPDGS--IAYKEYEDMIATRCTC 440

  Fly   701  700
            Mouse   441  440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 15/68 (22%)
TGF_beta 599..700 CDD:278448 28/115 (24%)
Gdf9NP_032136.2 TGF_beta_GDF9 336..441 CDD:381673 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.