DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf5

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_032135.2 Gene:Gdf5 / 14563 MGIID:95688 Length:495 Species:Mus musculus


Alignment Length:229 Identity:56/229 - (24%)
Similarity:97/229 - (42%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 WIEFDVTKAVRSWLNKSHENLGIEIQC-DKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLN 544
            |..||:.|..|::.|.:  .|.:|::. ::.:::..|.|..       ..||.......|..|  
Mouse   285 WEVFDIWKLFRNFKNSA--QLCLELEAWERGRAVDLRGLGF-------ERTARQVHEKALFLV-- 338

  Fly   545 IIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYK-----LHQRCCRN 604
                  ....:..|...::|...:.:.|:.|:.........|:....|...|     |..||.|.
Mouse   339 ------FGRTKKRDLFFNEIKARSGQDDKTVYEYLFSQRRKRRAPLANRQGKRPSKNLKARCSRK 397

  Fly   605 QLDVAFKSIKGFEFILQPKVFDAGYCHGRC--PPR-HNPAHHHALLQSLIWQEDHKRAPRPCCTP 666
            .|.|.||.:...::|:.|..::|.:|.|.|  |.| |....:||::|:|:...|.:..|..||.|
Mouse   398 ALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVP 462

  Fly   667 SKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            ::|..:.||.:|.  ::.:....:.||.|..|.|
Mouse   463 TRLSPISILFIDS--ANNVVYKQYEDMVVESCGC 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 8/24 (33%)
TGF_beta 599..700 CDD:278448 33/103 (32%)
Gdf5NP_032135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..162
TGFb_propeptide 139..338 CDD:279078 13/61 (21%)
TGFB 394..495 CDD:214556 33/103 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.