DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf10

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_665684.2 Gene:Gdf10 / 14560 MGIID:95684 Length:476 Species:Mus musculus


Alignment Length:221 Identity:62/221 - (28%)
Similarity:89/221 - (40%) Gaps:54/221 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 DFSPSTPPRSTA----------SSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQY 574
            ||.|...|.|:|          |.....|.:|.|:......|::|....   |:...:..|:   
Mouse   269 DFEPGAAPNSSADPRVRRAAQVSKPLQDNELPGLDERPAPALHAQNFHK---HEFWSSPFRA--- 327

  Fly   575 VHHRSNHDSTWRKDKWT-------------NNCYKLHQR-------CCRNQLDVAFKSIKGFEFI 619
            :..|:......:||:.|             ....|..:|       |.|..|.|.|..|...|:|
Mouse   328 LKPRTGRKDRKKKDQDTFTAASSQVLDFDEKTMQKARRRQWDEPRVCSRRYLKVDFADIGWNEWI 392

  Fly   620 LQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLIWQEDHKRA-------PRPCCTPSKLEMLEI 674
            :.||.|||.||.|.|.   |:.....:||.:||::      ||       |.|||.|.|:..|.:
Mouse   393 ISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIV------RAVGIVPGIPEPCCVPDKMNSLGV 451

  Fly   675 LHVDENHSDKLKISTWSDMQVVECAC 700
            |.:|||.:..||:  :.:|.|..|||
Mouse   452 LFLDENRNAVLKV--YPNMSVETCAC 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078
TGF_beta 599..700 CDD:278448 41/117 (35%)
Gdf10NP_665684.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..301 8/31 (26%)
TGF_beta 372..475 CDD:278448 40/110 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.