DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and admp

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_571951.2 Gene:admp / 140619 ZFINID:ZDB-GENE-011214-1 Length:391 Species:Danio rerio


Alignment Length:278 Identity:69/278 - (24%)
Similarity:119/278 - (42%) Gaps:59/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 LKVYQLLSANR------RRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEIQ 506
            :.|||:|.:::      ::.::||.:...:.|       |..|.:|:|||||::....|||:   
Zfish   147 VSVYQVLDSSKKNVSQGKKLLSSRLVPIHSTG-------WEVFTITQAVRSWMSDEGSNLGL--- 201

  Fly   507 CDKCKSIGARILSDFSPSTP-PRSTASSDEHLNLMPVLNIIGH-----GTLNSQQHGDADIH--- 562
                 .:..|.|:....... .|..:..|.|.:..|:|.:...     .:|.:...| :|:.   
Zfish   202 -----LVSVRTLAGSQMDLKMVRFASGRDHHHSKQPMLVLFTDDGRRAASLEATSKG-SDVSPGG 260

  Fly   563 -----QIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQP 622
                 ..:..:.||.:.|    ::|....|           ..|.|..|.|.|:.|....:|:.|
Zfish   261 SSQPLPSVPASRRSSRSV----DYDERGEK-----------MACQRQPLYVDFEEIGWSGWIVSP 310

  Fly   623 KVFDAGYCHGRC--PPRHN--PAHHHALLQSLI-WQEDHKRAPRPCCTPSKLEMLEILHVDENHS 682
            |.::|.:|.|.|  |...|  |. :||::||:| ..:.:|....|||.|.||..:.:|:.|::.:
Zfish   311 KGYNAYHCKGSCIFPLSQNMRPT-NHAIVQSIINTLKLNKGIQTPCCVPDKLYSISLLYFDDDEN 374

  Fly   683 DKLKISTWSDMQVVECAC 700
            ..||  .:.||....|.|
Zfish   375 VVLK--QYDDMVAGSCGC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 18/63 (29%)
TGF_beta 599..700 CDD:278448 35/105 (33%)
admpNP_571951.2 TGFb_propeptide 40..237 CDD:279078 25/104 (24%)
TGFB 289..391 CDD:214556 36/105 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.