DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf2

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_062379.3 Gene:Gdf2 / 12165 MGIID:1321394 Length:428 Species:Mus musculus


Alignment Length:358 Identity:81/358 - (22%)
Similarity:139/358 - (38%) Gaps:84/358 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 SSSLATNFRRGPGSRKNKISQISGND------------NIERHCNFGDVNLN-----QSNKNSSQ 444
            ||:.|:|..|. .|.::.||..:..|            :|.||.......|.     |::.:|:.
Mouse   100 SSTPASNIVRS-FSVEDAISTAATEDFPFQKHILIFNISIPRHEQITRAELRLYVSCQNDVDSTH 163

  Fly   445 QL--TLKVYQLLSANRR-RKITSRKIEFGNVGFQETRTQ-WIEFDVTKAVRSWL------NKSHE 499
            .|  ::.||.:|..:.. .:.|..|....:   |:.|.: |...:|:.||:.|:      ||:..
Mouse   164 GLEGSMVVYDVLEDSETWDQATGTKTFLVS---QDIRDEGWETLEVSSAVKRWVRADSTTNKNKL 225

  Fly   500 NLGIEIQCDKCKSI------GARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGD 558
            .:.::...:.|.::      |::.|..|...:..||..:.:..|.|.   .:|||.         
Mouse   226 EVTVQSHRESCDTLDISVPPGSKNLPFFVVFSNDRSNGTKETRLELK---EMIGHE--------- 278

  Fly   559 ADIHQIMLTNNRSDQY-VHHRSNHDS-----------TWRKDKWTNNCYKLHQRCCRNQLDVAFK 611
               .:.||.....:.| |...|..:.           ..|:.:.|.    ....|.:..|.|.|:
Mouse   279 ---QETMLVKTAKNAYQVAGESQEEEGLDGYTAVGPLLARRKRSTG----ASSHCQKTSLRVNFE 336

  Fly   612 SIKGFEFILQPKVFDAGYCHGRC---------PPRHNPAHHHALLQSLIWQEDHKRAPRPCCTPS 667
            .|....:|:.||.:||..|.|.|         |.:      ||::|:|:..:...:..:.||.|:
Mouse   337 DIGWDSWIIAPKEYDAYECKGGCFFPLADDVTPTK------HAIVQTLVHLKFPTKVGKACCVPT 395

  Fly   668 KLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            ||..:.||:.|:.....||.. :..|.|.||.|
Mouse   396 KLSPISILYKDDMGVPTLKYH-YEGMSVAECGC 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 16/73 (22%)
TGF_beta 599..700 CDD:278448 32/109 (29%)
Gdf2NP_062379.3 TGFb_propeptide 75..256 CDD:279078 34/159 (21%)
TGF_beta 325..427 CDD:278448 32/108 (30%)
Interaction with ENG. /evidence=ECO:0000250|UniProtKB:Q9UK05 401..415 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.