DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp8b

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_031585.2 Gene:Bmp8b / 12164 MGIID:107335 Length:399 Species:Mus musculus


Alignment Length:299 Identity:58/299 - (19%)
Similarity:113/299 - (37%) Gaps:102/299 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 LTLKVYQLLSANRRRK-----ITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIE- 504
            |.:.:::::..:..|:     :..:.:..|:.|       |:..|:|.|...||...|::||:. 
Mouse   158 LHISMFEVVQEHSNRESDLFFLDLQTLRSGDEG-------WLVLDITAASDRWLLNHHKDLGLRL 215

  Fly   505 -IQCDKCKSIG---ARIL-----------------SDFSPSTPPRST--------------ASSD 534
             ::.:...||.   |.:|                 ::.||...||:.              ..|:
Mouse   216 YVETEDGHSIDPGLAGLLGRQAPRSRQPFMVGFFRANQSPVRAPRTARPLKKKQLNQINQLPHSN 280

  Fly   535 EHLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQ 599
            :||.::.    .|||:     ||                                        .:
Mouse   281 KHLGILD----DGHGS-----HG----------------------------------------RE 296

  Fly   600 RCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNP---AHHHALLQSLIWQEDHKRAPR 661
            .|.|::|.|:|:.:...:.::.|:.:.|.||.|.|....|.   :.:||.:|:|:........|:
Mouse   297 VCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIIPK 361

  Fly   662 PCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            .||.|::|..:.:|:.|.|::..|:..  .:|.|..|.|
Mouse   362 VCCVPTELSAISLLYYDRNNNVILRRE--RNMVVQACGC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 13/66 (20%)
TGF_beta 599..700 CDD:278448 28/103 (27%)
Bmp8bNP_031585.2 TGFb_propeptide 32..248 CDD:279078 17/96 (18%)
TGF_beta 298..398 CDD:278448 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.