DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp8a

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001242948.1 Gene:Bmp8a / 12163 MGIID:104515 Length:412 Species:Mus musculus


Alignment Length:293 Identity:63/293 - (21%)
Similarity:116/293 - (39%) Gaps:77/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 LTLKVYQLLSANRRRK-----ITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEI 505
            |.:.:::::..:..|:     :..:.:..|:.|       |:..|:|.|...||...|::||:.:
Mouse   158 LHISMFEVVQEHSNRESDLFFLDLQTLRSGDEG-------WLVLDITAASDRWLLNHHKDLGLRL 215

  Fly   506 QCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNR 570
            ..:                       ::|.|.....:..::|.....|:|       ..|:|..|
Mouse   216 YVE-----------------------TADGHSMDPGLAGLLGRQAPRSRQ-------PFMVTFFR 250

  Fly   571 SDQYVHH--RSNHDSTWRKDKWTNNC---YKL------------HQRCCRNQLDVAFKSIKGFEF 618
            :.|....  |:......|:.|.||..   .||            .:.|.|::|.|:|:.:...::
Mouse   251 ASQSPVRAPRAARPLKRRQPKKTNELPHPNKLPGIFDDGHGSRGREVCRRHELYVSFRDLGWLDW 315

  Fly   619 ILQPKVFDAGYCHGRCP-PRHN--PAHHHALLQSLI---------WQEDHKR----APRPCCTPS 667
            ::.|:.:.|.||.|.|. |..:  .|.:||:||||:         |...|..    .|:.||.|:
Mouse   316 VIAPQGYSAYYCEGECAFPLDSCMNATNHAILQSLVSTTVACCDRWSGVHLMKPDVVPKACCAPT 380

  Fly   668 KLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            ||....:|:.|.  |:.:.:....:|.|..|.|
Mouse   381 KLSATSVLYYDS--SNNVILRKHRNMVVKACGC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 13/64 (20%)
TGF_beta 599..700 CDD:278448 33/116 (28%)
Bmp8aNP_001242948.1 TGFb_propeptide 32..248 CDD:279078 19/126 (15%)
TGF_beta 298..411 CDD:278448 33/114 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.