DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp5

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_031581.2 Gene:Bmp5 / 12160 MGIID:88181 Length:454 Species:Mus musculus


Alignment Length:347 Identity:72/347 - (20%)
Similarity:145/347 - (41%) Gaps:51/347 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PLTNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHCNFGDVNL 435
            ||.:..|.||.:| .|.....:.|:......::.||.....:..::||...:.:.. ..|.....
Mouse   141 PLASLHDTNFLND-ADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTA-AEFRIYKD 203

  Fly   436 NQSNKNSSQQLTLKVYQLLSANRRRK-----ITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLN 495
            ..:::..::.:.:.:||::.....|.     :.:||.:..:||       |:.||:|.....|:.
Mouse   204 KGNHRFENETIKISIYQIIKEYTNRDADLFLLDTRKTQALDVG-------WLVFDITVTSNHWVI 261

  Fly   496 KSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIG-HGTLNSQ----- 554
            ....|||:::    |...|                  ....:|:... .::| ||..:.|     
Mouse   262 NPQNNLGLQL----CAETG------------------DGRSINVKSA-GLVGRHGPQSKQPFMVA 303

  Fly   555 --QHGDADIHQIMLTNNRSDQYVHHRSNH-DSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGF 616
              :..:..:..:...:.|.:|..:..::| |.:........|..:..|.|.:::|.|:|:.:...
Mouse   304 FFKASEVLLRSVRAASKRKNQNRNKSNSHQDPSRMPSAGDYNTSEQKQACKKHELYVSFRDLGWQ 368

  Fly   617 EFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVD 678
            ::|:.|:.:.|.||.|.|.   ..|..|.:||::|:|:........|:|||.|:||..:.:|:.|
Mouse   369 DWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFD 433

  Fly   679 ENHSDKLKISTWSDMQVVECAC 700
            :  |..:.:..:.:|.|..|.|
Mouse   434 D--SSNVILKKYRNMVVRSCGC 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 15/68 (22%)
TGF_beta 599..700 CDD:278448 31/103 (30%)
Bmp5NP_031581.2 TGFb_propeptide 31..304 CDD:279078 35/194 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..347 5/28 (18%)
TGF_beta 351..453 CDD:278448 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.