DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp4

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001303289.1 Gene:Bmp4 / 12159 MGIID:88180 Length:408 Species:Mus musculus


Alignment Length:398 Identity:91/398 - (22%)
Similarity:151/398 - (37%) Gaps:97/398 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 RLNQNPKKHQNYGDLLRG-----------EQDTMNILLHFPLTNAQDAN----FHHDK------- 384
            |....|.|.....|.:|.           |:.:....|.:|...|..||    |||::       
Mouse    68 RRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLENIPG 132

  Fly   385 IDEANVRLMLLYSSSLATN----------FRRGPGSRKNKISQISGNDNIERHCNFGDVNLNQSN 439
            ..|::....|...||:..|          ||          .|:....:.|:  .|..:|:.:..
Mouse   133 TSESSAFRFLFNLSSIPENEVISSAELRLFR----------EQVDQGPDWEQ--GFHRINIYEVM 185

  Fly   440 KNSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIE 504
            |..:        :::..:...::...::...||      |:|..|||:.||..|..:...|.|:.
Mouse   186 KPPA--------EMVPGHLITRLLDTRLVHHNV------TRWETFDVSPAVLRWTREKQPNYGLA 236

  Fly   505 IQCDKCKSI----GARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQIM 565
            |:.......    |..:  ..|.|.|    ..|.:...|.|:|...||         |...|  .
Mouse   237 IEVTHLHQTRTHQGQHV--RISRSLP----QGSGDWAQLRPLLVTFGH---------DGRGH--T 284

  Fly   566 LTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYC 630
            ||..|:.:...|   |....||.         ::.|.|:.|.|.|..:...::|:.|..:.|.||
Mouse   285 LTRRRAKRSPKH---HPQRSRKK---------NKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYC 337

  Fly   631 HGRCP---PRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSD 692
            ||.||   ..|..:.:||::|:|: ...:...|:.||.|::|..:.:|::||  .||:.:..:.:
Mouse   338 HGDCPFPLADHLNSTNHAIVQTLV-NSVNSSIPKACCVPTELSAISMLYLDE--YDKVVLKNYQE 399

  Fly   693 MQVVECAC 700
            |.|..|.|
Mouse   400 MVVEGCGC 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 12/63 (19%)
TGF_beta 599..700 CDD:278448 32/103 (31%)
Bmp4NP_001303289.1 TGFb_propeptide 41..276 CDD:279078 47/239 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..111 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..307 8/39 (21%)
TGFB 308..408 CDD:214556 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.