DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp2

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_031579.2 Gene:Bmp2 / 12156 MGIID:88177 Length:394 Species:Mus musculus


Alignment Length:349 Identity:82/349 - (23%)
Similarity:136/349 - (38%) Gaps:92/349 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 NFHHDKIDE-------ANVRLMLLYSSSLATN----------FRRGPGSRKNKISQISGNDNIER 426
            :|||::..|       ...|......||:.::          ||       .:|.:..||.:.:.
Mouse   110 SFHHEEAVEELPEMSGKTARRFFFNLSSVPSDEFLTSAELQIFR-------EQIQEALGNSSFQH 167

  Fly   427 HCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVR 491
            .     :|:.:..|.::..|...|.:||......:.||               ||..||||.||.
Mouse   168 R-----INIYEIIKPAAANLKFPVTRLLDTRLVNQNTS---------------QWESFDVTPAVM 212

  Fly   492 SWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASS-----DEH--LNLMPVLNIIGHG 549
            .|..:.|.|.|..::....:.         :|....|....|     |||  ..:.|:|...|| 
Mouse   213 RWTTQGHTNHGFVVEVAHLEE---------NPGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGH- 267

  Fly   550 TLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIK 614
                    |...|.:           |.|....:..::.|      :|...|.|:.|.|.|..:.
Mouse   268 --------DGKGHPL-----------HKREKRQAKHKQRK------RLKSSCKRHPLYVDFSDVG 307

  Fly   615 GFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILH 676
            ..::|:.|..:.|.||||.||   ..|..:.:||::|:|: ...:.:.|:.||.|::|..:.:|:
Mouse   308 WNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLV-NSVNSKIPKACCVPTELSAISMLY 371

  Fly   677 VDENHSDKLKISTWSDMQVVECAC 700
            :|||  :|:.:..:.||.|..|.|
Mouse   372 LDEN--EKVVLKNYQDMVVEGCGC 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 18/63 (29%)
TGF_beta 599..700 CDD:278448 33/103 (32%)
Bmp2NP_031579.2 TGFb_propeptide 43..265 CDD:279078 40/190 (21%)
TGFB 294..394 CDD:214556 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.