DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp3

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001297606.1 Gene:Bmp3 / 110075 MGIID:88179 Length:470 Species:Mus musculus


Alignment Length:371 Identity:69/371 - (18%)
Similarity:113/371 - (30%) Gaps:142/371 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 HDKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHCNFGDVNLNQSNKNSSQQL 446
            |||:.|..:.|...||.|......|.|||:......:.|.:.:.        :...:...:.|..
Mouse    53 HDKVSEHMLWLYDRYSGSSRVQATRTPGSQLPGPQPLRGGNTVR--------SFRAAAAGTPQTK 109

  Fly   447 TLKVYQLLSANRRRKITSRKI-----EFGNVGF---------QETRTQWIEFDVTKAVRSWLNKS 497
            .|..:.|.|..:...|.|..:     |..|:..         ..|:.|.|:.|::    :|:.||
Mouse   110 GLHTFNLTSLTKSENILSATLYFYVGELVNISLSCPEPQGCSHHTQRQHIQIDLS----AWILKS 170

  Fly   498 HE-----NLGIEI-----------------QCDKCKS-----IGARILS---------------- 519
            ::     :|.:::                 ...|.|.     ||..|.|                
Mouse   171 NQSQLLGHLSVDVVRPYRDSVSWLSKDITQLLRKAKQNEEFLIGFNITSRAHELPKRMLFFPEPY 235

  Fly   520 ------------------------DFSPSTPPRSTASSDEHLN-----------LMPVLN--IIG 547
                                    ||:..|.||..:...|.|:           |:|:.|  :.|
Mouse   236 ILVYANDAAISEPESVVSSLQRHRDFTAGTGPRLDSHVREALSVERRKKRSTGILLPLQNNELPG 300

  Fly   548 ----------------HGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTW--------RKD 588
                            :.:|.:|....:       .|.:..:...|:......:        |:.
Mouse   301 AEYQYKEEGAWEERKPYKSLQTQPPEKS-------RNKKKQRKGSHQKGQTLQFDEQTLKKARRK 358

  Fly   589 KWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRC 634
            :|..     .:.|.|..|.|.|..|...|:|:.||.|||.||.|.|
Mouse   359 QWVE-----PRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGAC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 16/99 (16%)
TGF_beta 599..700 CDD:278448 17/36 (47%)
Bmp3NP_001297606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..53 69/371 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..349 4/41 (10%)
TGF_beta 364..>424 CDD:278448 17/36 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.