DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and GDF11

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_005802.1 Gene:GDF11 / 10220 HGNCID:4216 Length:407 Species:Homo sapiens


Alignment Length:252 Identity:62/252 - (24%)
Similarity:94/252 - (37%) Gaps:69/252 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 RRRKITSRKIEFGNVGFQETRT-QWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDF 521
            |..:|.|.|||.      .:|: .|...|..:.:.||..:...|.||||..             |
Human   217 RHIRIRSLKIEL------HSRSGHWQSIDFKQVLHSWFRQPQSNWGIEINA-------------F 262

  Fly   522 SPSTPPRSTASSDEHLNLMPVLNIIGHGT---LNSQQHGDADIHQIM----LTNNRSDQYVHHRS 579
            .||                        ||   :.|...|...:|..|    |.|.:       ||
Human   263 DPS------------------------GTDLAVTSLGPGAEGLHPFMELRVLENTK-------RS 296

  Fly   580 NHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHH 644
            ..:.....|:     :....||||..|.|.|::. |:::|:.||.:.|.||.|:|.......:.|
Human   297 RRNLGLDCDE-----HSSESRCCRYPLTVDFEAF-GWDWIIAPKRYKANYCSGQCEYMFMQKYPH 355

  Fly   645 ALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            .   .|:.|.:.:.:..|||||:|:..:.:|:.  |...::.......|.|..|.||
Human   356 T---HLVQQANPRGSAGPCCTPTKMSPINMLYF--NDKQQIIYGKIPGMVVDRCGCS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 15/48 (31%)
TGF_beta 599..700 CDD:278448 30/100 (30%)
GDF11NP_005802.1 TGFb_propeptide 61..285 CDD:366248 24/110 (22%)
TGF_beta_GDF8 301..407 CDD:381658 31/116 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.