DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and LOC101732995

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001297040.1 Gene:LOC101732995 / 101732995 -ID:- Length:401 Species:Xenopus tropicalis


Alignment Length:429 Identity:82/429 - (19%)
Similarity:149/429 - (34%) Gaps:121/429 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 TTNGFNDISNKRLRHRRSLKKINRLNQNPKKHQNYGDLLRGEQDTMNILLHFPLTNAQDANFHHD 383
            |.||..|...::..|.......|.:::..|...|.......|.||:...:....|..        
 Frog    40 TDNGARDFHGRKFPHFMMQLYQNIISRRDKDLSNLEHPTLQESDTVQSFIAKSYTTV-------- 96

  Fly   384 KIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHC--NFGDVNLNQSNKNSSQQL 446
                .|...:....||::|       |.:.|::::       |.|  :||          .|..:
 Frog    97 ----GNHWTLFFDMSSIST-------SNELKLAEL-------RICLPSFG----------KSHSV 133

  Fly   447 TLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIE-----FDVTKAVRSW------------- 493
            |:::|       ..|.|..|:..|:  |:...:..::     |::|..:.::             
 Frog   134 TVEIY-------HTKDTKEKLFMGS--FKTKISSALDADCKVFNLTMVLHNYLIRGKRLIKDEYI 189

  Fly   494 ---------LNKSHENLGIE----IQCDKCKSIGARILSDFSPS-------TPPRSTASSDE--- 535
                     |.||....|.|    ::.||..      :|||:..       ...||.|..|.   
 Frog   190 QAKGLLLRDLEKSAAEKGAENVDTLKQDKYH------VSDFAAERIILVVFAKERSQAKPDPPSL 248

  Fly   536 HLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWT---NNCYKL 597
            ...|.|:            ::|.||      ..|:.:.:...|.|.....|.|..|   ....::
 Frog   249 GKQLFPL------------KYGMAD------NANKVNGFRRLRRNKKEKTRIDVGTTPPKPVEEI 295

  Fly   598 HQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHN---PAHHHALLQSLIWQEDHKRA 659
            ..:|.:..:.|.|:.|....:|:.||.::|..|...|....|   .|.:::.::||:...|.:|.
 Frog   296 KPKCRKVDMFVDFQKIGWGSWIVYPKAYNAYRCESACAVPLNETDDATNYSYIKSLLPLSDTERR 360

  Fly   660 PRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVEC 698
            ..|.|.|.|:..:.:|:.:   ::...:....:|.|.||
 Frog   361 ECPSCVPVKMRSMSMLYYE---NEDFVLRHHEEMIVEEC 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 15/94 (16%)
TGF_beta 599..700 CDD:278448 25/103 (24%)
LOC101732995NP_001297040.1 TGFb_propeptide 53..>139 CDD:279078 21/128 (16%)
TGFB 299..397 CDD:214556 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.