DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and tgfb2

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_002936067.1 Gene:tgfb2 / 100489680 XenbaseID:XB-GENE-480560 Length:411 Species:Xenopus tropicalis


Alignment Length:440 Identity:106/440 - (24%)
Similarity:173/440 - (39%) Gaps:101/440 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 LSITTNGFNDIS---NKRLRHRRS--LKKINRLNQNPKKHQNYGDLLRGEQDTMNI------LLH 369
            ||::|....|:.   .||:...|.  |.|: :||..|:.:...|::   .||.:.|      ||.
 Frog    19 LSLSTCSTLDMDQFMRKRIEAIRGQILSKL-KLNSPPEDYPEPGEV---SQDVIAIYNSTRDLLQ 79

  Fly   370 FPLTNAQDANFHHDKIDEA-------NVRLMLLYSS------SLATNFRR-----GPGSRKNKIS 416
             ...|.:.|:...::.::.       .:.::..|:|      |..|.:.|     .....||..:
 Frog    80 -EKANERAASCERERSEDEYYAKEVYKIDMLPYYTSENVIPPSYTTPYFRIVRFDVSSMEKNASN 143

  Fly   417 QISGNDNIERHCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRT-- 479
            .:.....:.|       .:|...:.|.|::.|  ||:|.:......|.|.|:...|   :||.  
 Frog   144 LVKAEFRVFR-------LMNPKARVSEQRIEL--YQILKSKDLASPTQRYIDSKVV---KTRAEG 196

  Fly   480 QWIEFDVTKAVRSWLNKSHENLG--IEIQCDKCKSIGAR--ILSDFSPSTPPR------------ 528
            :|:.||||:|:..||:....|||  |.:.|..|..|.:.  |:.:.|.....|            
 Frog   197 EWLSFDVTEAINEWLHHKDRNLGFKISLHCPCCTFIPSNNYIIPNKSEELETRFAGIDDAYMYAG 261

  Fly   529 --STASSDEHLNLMP--VLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDK 589
              .|.|..:|....|  :|.::....|.|||                           |:.||.:
 Frog   262 DPKTKSRKKHTGRTPHLLLMLLPSYRLESQQ---------------------------SSRRKKR 299

  Fly   590 WTNNCY---KLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLI 651
            ..:..|   .:...||...|.:.||...|:::|.:||.::|.:|.|.||...:....|:.:.||.
 Frog   300 ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLY 364

  Fly   652 WQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            ...:.:.:..|||....|:.|.||:...|   |.||...|:|.|..|.||
 Frog   365 NTINPEASASPCCVSQDLDSLTILYYIGN---KPKIEQLSNMIVKSCKCS 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 24/67 (36%)
TGF_beta 599..700 CDD:278448 32/100 (32%)
tgfb2XP_002936067.1 TGFb_propeptide 21..228 CDD:366248 52/223 (23%)
TGF_beta_TGFB2 314..410 CDD:381655 32/98 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.