DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and bmp10

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_002935357.1 Gene:bmp10 / 100487047 XenbaseID:XB-GENE-478875 Length:421 Species:Xenopus tropicalis


Alignment Length:298 Identity:74/298 - (24%)
Similarity:125/298 - (41%) Gaps:66/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 LKVYQLLSANRR------RKI-----------TSRKIEFGNVGFQETRTQWIEFDVTKAVRSW-- 493
            ||:|.::...|.      ||:           |.|.:|..:....:|.::|..||:|:|||.|  
 Frog   144 LKLYMMVPRERMKFEGVGRKVTVYEIYSEGEDTIRAVELASRLVYKTSSEWQMFDITEAVRRWSR 208

  Fly   494 ------------------LNKSHE-NLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNL 539
                              |..|.| ||.||::.:........:.||         ..|||:....
 Frog   209 SEFATHRLEVQVQNPDVDLEGSGEGNLDIEVRPESKHEPFLVVFSD---------DQSSDKKEEK 264

  Fly   540 MPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQ-YVHHRSN--HDSTWRKDKWTNNCYKLHQRC 601
            ..:..:|.|.....|::|:    .|.|.|..|:: .:..|||  :|::.|..:.....|     |
 Frog   265 EELEEMITHEEGLDQENGE----DIGLGNGLSEESLLQMRSNIIYDASSRIRRNAKGNY-----C 320

  Fly   602 CRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLIWQEDHKRAPRPC 663
            .:..|.:.|..|....:|:.|:.::|..|.|.|.   ..|.....||::|:|:..::.::|.:.|
 Frog   321 KKTPLYIDFGEIGWNSWIIAPQGYEAYECRGVCSYPLTEHVTPTKHAIVQTLVHMKNAQKASKAC 385

  Fly   664 CTPSKLEMLEILHVDEN-HSDKLKISTWSDMQVVECAC 700
            |..:||:.:.||::|.. .:.|.|   :..|.|.||.|
 Frog   386 CVATKLDPISILYLDAGVVTYKFK---YEGMVVAECGC 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 25/95 (26%)
TGF_beta 599..700 CDD:278448 29/104 (28%)
bmp10XP_002935357.1 TGFb_propeptide 52..252 CDD:366248 25/107 (23%)
TGF_beta_BMP10 318..421 CDD:381671 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.