DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and bmp16

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001165247.1 Gene:bmp16 / 100329171 ZFINID:ZDB-GENE-100115-1 Length:416 Species:Danio rerio


Alignment Length:419 Identity:92/419 - (21%)
Similarity:150/419 - (35%) Gaps:148/419 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 DLLRGEQDTMNIL----LHFPLTNAQDAN----FHH-------------DKIDEANV-------- 390
            ||.|......:::    ..:|..:.|.||    |||             ..:|..::        
Zfish    72 DLYRFHTQQYHLIEDPEFSYPSKHVQGANTVRCFHHTDSPTPSLPEEQKTTVDGIHIGFNLSSIP 136

  Fly   391 --------RLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHCNFGDVNLNQSNKN-SSQQL 446
                    .|.||:..|                   ||..::        .:|..||.: ||:.:
Zfish   137 SEESVVSAELRLLHEGS-------------------SGGSHV--------ASLYLSNHDPSSKPI 174

  Fly   447 TLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCK 511
            .|...||   .|.||               :...|..|.:.:.|...|:|:..:|.         
Zfish   175 LLHSRQL---TRDRK---------------SAQLWETFPLDREVFQNLSKTSGSLS--------- 212

  Fly   512 SIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQ--IMLT---NNRS 571
                 .:.|..|.:...||...|.||.       :...||   |.|.....|  :::|   :.||
Zfish   213 -----FILDVIPDSNSSSTLPKDRHLR-------VRRSTL---QDGPTWERQRPLLVTYSHDGRS 262

  Fly   572 DQYVHHRSNHDSTWRKDKWT-------------------NN--CYKLHQ----RCCRNQLDVAFK 611
            :.:| :.:...|:..:.:||                   ||  ..||.:    ||.|:.|.|.||
Zfish   263 EPFV-NLNKRKSSRSRSRWTRFKGDRGQGSDWNERRVKRNNRRAAKLKRLSRARCRRHPLYVDFK 326

  Fly   612 SIKGFEFILQPKVFDAGYCHGRCPPRHNPAHH-----HALLQSLIWQEDHKRAPRPCCTPSKLEM 671
            .:...::|:.|..:||.:|.|.|  |...|.|     ||::|:|: ...:...|||||.|:.|..
Zfish   327 DVGWNKWIIAPSGYDAFFCLGEC--RFPLADHMNSSSHAMVQTLV-SSVNGAVPRPCCVPTALSP 388

  Fly   672 LEILHVDENHSDKLKISTWSDMQVVECAC 700
            :.:|.:|:  .:::.:..:.||.|..|.|
Zfish   389 IALLFLDQ--EERVVLKNYQDMVVEGCGC 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 14/63 (22%)
TGF_beta 599..700 CDD:278448 34/109 (31%)
bmp16NP_001165247.1 TGFb_propeptide 43..256 CDD:279078 46/252 (18%)
TGFB 316..416 CDD:214556 34/105 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.