DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eph and AT1G69990

DIOPT Version :9

Sequence 1:NP_524625.3 Gene:Eph / 43803 FlyBaseID:FBgn0025936 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_177157.1 Gene:AT1G69990 / 843336 AraportID:AT1G69990 Length:591 Species:Arabidopsis thaliana


Alignment Length:511 Identity:97/511 - (18%)
Similarity:197/511 - (38%) Gaps:114/511 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 DLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSALN-------TKETKAHIVGLLEN-------- 597
            ||..:| :....|.:..:.::...:   |:|::.|.       |:..:...:.|.:|        
plant   120 DLSGNK-LSGSIPSQIVDCKFLNSL---ALNQNKLTGSIPSELTRLNRLQRLSLADNDLSGSIPS 180

  Fly   598 --TEYGFQVRCKTNNGFGSYSNMIYAQTLQSVGSVYDDSVQIRFIAGAIVTGVLFLVIFIIATVY 660
              :.||       .:||.....:. .:.|.:.||....::.|...||.|.......|.|.:...:
plant   181 ELSH
YG-------EDGFRGNGGLC-GKPLSNCGSFNGKNLTIIVTAGVIGAVGSLCVGFGMFWWF 237

  Fly   661 FMRSKHQDDLDKKSTNHLPLPLDYASNEVNSMDTTPIVKKLHLNVTTPLFGNSRSYVDPHTYEDP 725
            |:|       |::..|      :|........|.:..:..|          .|...|....::.|
plant   238 FIR-------DRRKMN------NYGYGAGKCKDDSDWIGLL----------RSHKLVQVTLFQKP 279

  Fly   726 NQAIR-----EFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKA 785
            ...|:     |.....|:..|.:.:..|.....|:..|.           .:.:|.|. ...|.:
plant   280 IVKIKLVDLIEATNGFDSGNIVVSSRSGVSYKADLPDGS-----------TLEVKRLS-SCCELS 332

  Fly   786 RCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLR 850
            ...|.:|.:.:||..|||::.|.|.....:.::::.::|.||:|.:.|:..|..:.|...:.:  
plant   333 EKQFRSEINKLGQIRHPNLVPLLGFCVVEDEILLVYKHMANGTLYSQLQQWDIDWPTRVRVAV-- 395

  Fly   851 GIASGMSYL---SDMNYVHRDLAARNVLVNAQLICKIADFGLSREI--ENASDAYTTRGGKIPVR 910
            |.|.|:::|   ....|:|:.:::..:|::.....::.|:||.:.:  :::.|:..:.|   ...
plant   396 GAARGLAWLHHGCQPLYMHQYISSNVILLDEDFDARVIDYGLGKLVSSQDSKDSSFSNG---KFG 457

  Fly   911 WTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPY---------------W------NWSNQDV 954
            :.|||..:....:.:.||:.:|:||.|::: |::|.               |      |..::|.
plant   458 YVAPEYSSTMVASLSGDVYGFGIVLLEIVT-GQKPVLINNGEEGFKESLVEWVSKHLSNGRSKDA 521

  Fly   955 I--KSIEKGYRLPAPMDCPEALYQLM---LDCWQKQRTHRPTFASIVSTLDNLARQ 1005
            |  :...|||        .:.:.|::   ..|...:...||....:..:|.||..|
plant   522 IDRRIFGKGY--------DDEIMQVLRIACSCVVSRPKERPLMIQVYESLKNLGDQ 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphNP_524625.3 EphR_LBD 85..260 CDD:198439
FN3 387..476 CDD:238020
FN3 536..623 CDD:238020 14/91 (15%)
EphA2_TM 644..736 CDD:291255 15/96 (16%)
PTKc_EphR 736..1002 CDD:270629 59/296 (20%)
Pkinase_Tyr 741..999 CDD:285015 57/288 (20%)
SAM_1 1033..1092 CDD:278937
SAM 1039..1092 CDD:197735
AT1G69990NP_177157.1 PLN00113 1..>182 CDD:215061 10/65 (15%)
leucine-rich repeat 70..90 CDD:275380
leucine-rich repeat 91..115 CDD:275380
leucine-rich repeat 116..139 CDD:275380 4/19 (21%)
leucine-rich repeat 140..163 CDD:275380 4/25 (16%)
leucine-rich repeat 164..184 CDD:275380 2/19 (11%)
PKc_like 303..566 CDD:389743 57/288 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.