DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eph and YDA

DIOPT Version :9

Sequence 1:NP_524625.3 Gene:Eph / 43803 FlyBaseID:FBgn0025936 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_001319310.1 Gene:YDA / 842674 AraportID:AT1G63700 Length:883 Species:Arabidopsis thaliana


Alignment Length:372 Identity:90/372 - (24%)
Similarity:156/372 - (41%) Gaps:64/372 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 SKHQDDLDKKSTNHLPLPLDYASNEVNSMDTTPIVKKLHLNVTTPLFGNSRSYVDPHTYEDPNQA 728
            ::..|| :::.::.||||....||      |.|.         :|.:..:.|   |.....|.:|
plant   345 TRRLDD-NRQQSHRLPLPPLLISN------TCPF---------SPTYSAATS---PSVPRSPARA 390

  Fly   729 IREFAREIDANYITIEA------------IIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGS 781
                           ||            ::|.|.||.|..|............:|.:.:..|.|
plant   391 ---------------EATVSPGSRWKKGRLLGMGSFGHVYLGFNSESGEMCAMKEVTLCSDDPKS 440

  Fly   782 SEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLI 846
            .|.|: ....|.|::.:..|.|::...|..|..:.:.|..||:..||:...|: ..|:|....:.
plant   441 RESAQ-QLGQEISVLSRLRHQNIVQYYGSETVDDKLYIYLEYVSGGSIYKLLQ-EYGQFGENAIR 503

  Fly   847 VMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIENASDAYTTRGGKIPVRW 911
            ...:.|.||::||...|.||||:...|:||:.....|:||||:::.|...|...:.:|...   |
plant   504 NYTQQILSGLAYLHAKNTVHRDIKGANILVDPHGRVKVADFGMAKHITAQSGPLSFKGSPY---W 565

  Fly   912 TAPEAIAFRKFTS-ASDVWSYGVVLWEVMSYGERPYWN-WSNQDVIKSIEKGYRLPAPMDCPEAL 974
            .|||.|.....:: |.|:||.|..:.|:.:  .:|.|: :.....:..|.....||   |.|:.|
plant   566 MAPEVIKNSNGSNLAVDIWSLGCTVLEMAT--TKPPWSQYEGVPAMFKIGNSKELP---DIPDHL 625

  Fly   975 YQ----LMLDCWQKQRTHRPTFASIV--STLDNLARQPQSLLTTRPS 1015
            .:    .:..|.|:...:|||.|.::  :.:.|:....:.:::..|:
plant   626 SEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRNVMPMERPIVSGEPA 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphNP_524625.3 EphR_LBD 85..260 CDD:198439
FN3 387..476 CDD:238020
FN3 536..623 CDD:238020
EphA2_TM 644..736 CDD:291255 15/71 (21%)
PTKc_EphR 736..1002 CDD:270629 73/285 (26%)
Pkinase_Tyr 741..999 CDD:285015 73/277 (26%)
SAM_1 1033..1092 CDD:278937
SAM 1039..1092 CDD:197735
YDANP_001319310.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.