DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eph and AT1G51830

DIOPT Version :9

Sequence 1:NP_524625.3 Gene:Eph / 43803 FlyBaseID:FBgn0025936 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_001323323.1 Gene:AT1G51830 / 841610 AraportID:AT1G51830 Length:700 Species:Arabidopsis thaliana


Alignment Length:762 Identity:171/762 - (22%)
Similarity:269/762 - (35%) Gaps:215/762 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 PAKNESFSSETNSKIYHSDIVYKIKCNICSP-----------NVVY--NPSTDTF---------- 451
            |....|::..|.:...:...:|::..::.|.           |:.:  .|.|..|          
plant    30 PIFQNSWTQVTTNLNVNISTIYELPQSVMSTAATPLNANATLNITWTIEPPTTPFYSYIHFAELQ 94

  Fly   452 ----NETK---ITLT--------NLEPVTTYTVQ---------------------------IHAI 474
                |:|:   :||.        :.:|:.|.|:|                           ::||
plant    95 SLRANDTREFNVTLNGEYTIGPYSPKPLKTETIQDLSPEQCNGGACILQLVETLKSTLPPLLNAI 159

  Fly   475 NSVSHINEFKRHSNESSLVAVSDIVFSNTSLLN---------IP-------LDLNEVKTGQAEIV 523
            .:.:.|:..:..:||..:..::|:  .||..||         :|       |:.|........|:
plant   160 EAFTVIDFPQMETNEDDVTGINDV--QNTYGLNRISWQGDPCVPKQYSWDGLNCNNSDISIPPII 222

  Fly   524 FTTE--SVLLSTVFNLRILAITN-KDADLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSA---L 582
            .:.:  |..|:.|....|..:|: :..||. |..:..|.|....:::....:.|...|.:.   |
plant   223 ISLDLSSSGLNGVITQGIQNLTHLQYLDLS-DNNLTGDIPKFLADIQSLLVINLSGNNLTGSVPL 286

  Fly   583 NTKETKAHIVGLLENTEYGFQVRCK----TNNGFGSYSNMIYAQTLQSVGSVYDDSVQIRFIAGA 643
            :..:.|    ||..|.|....:.|.    .|.|.|.....|.|..:.|:.|       |..:.||
plant   287 SLLQKK----GLKLNVEGNPHLLCTDGLCVNKGDGHKKKSIIAPVVASIAS-------IAILIGA 340

  Fly   644 IVTGVLFLVIFIIATVYFMRSKHQDDLDKKSTNHLPLPLDY--ASNEVNSMDTTPIVKKLHLNVT 706
            :   |||.|:                  ||.|.....|..|  |||                   
plant   341 L---VLFFVL------------------KKKTQSKGPPAAYVQASN------------------- 365

  Fly   707 TPLFGNSRSYVDP--------HTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIP 763
                |.||...:|        .||.:..|....|.|           ::|.|.||.|..|.:   
plant   366 ----GRSRRSAEPAIVTKNKRFTYSEVMQMTNNFQR-----------VLGKGGFGIVYHGLV--- 412

  Fly   764 PNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGS 828
             |..:  .||||.|...||:..: .|..|..::.:..|.|::.|.|.......:.:|.|||.||.
plant   413 -NGTE--QVAIKILSHSSSQGYK-QFKAEVELLLRVHHKNLVGLVGYCDEGENLALIYEYMANGD 473

  Fly   829 LDTFLRVNDGKF-----QTLQLIVMLRGIASGMSYLSD---MNYVHRDLAARNVLVNAQLICKIA 885
            |...:......|     ..|:::|   ..|.|:.||.:   ...||||:...|:|:|.|...|:|
plant   474 LKEHMSGTRNHFILNWGTRLKIVV---ESAQGLEYLHNGCKPLMVHRDIKTTNILLNEQFDAKLA 535

  Fly   886 DFGLSRE--IENASDAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMS-------Y 941
            ||||||.  ||..:...|...|  ...:..||.......|..|||:|:||||.|:::       .
plant   536 DFGLSRSFPIEGETHVSTAVAG--TPGYLDPEYYRTNWLTEKSDVYSFGVVLLEIITNQPVIDPR 598

  Fly   942 GERPY-WNWSNQDVIKSIEKGYRLPA---PMDCPEA--LYQLMLDCWQKQRTHRPTFASIVSTLD 1000
            .|:|: ..|..:.:.|...|....|:   ..|....  ..:|.:.|.......||..:.:|..|:
plant   599 REKPHIAEWVGEVLTKGDIKNIMDPSLNGDYDSTSVWKAVELAMCCLNPSSARRPNMSQVVIELN 663

  Fly  1001 NLARQPQSLLTTRPSPESDGNHILDGQRGQNIFISTDLWLEHIKMSR 1047
                   ..||   |..|.|..|.|.....:|.:|.....|...::|
plant   664 -------ECLT---SENSRGGAIRDMDSEGSIEVSLTFGTEVTPLAR 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphNP_524625.3 EphR_LBD 85..260 CDD:198439
FN3 387..476 CDD:238020 19/130 (15%)
FN3 536..623 CDD:238020 21/94 (22%)
EphA2_TM 644..736 CDD:291255 21/101 (21%)
PTKc_EphR 736..1002 CDD:270629 79/288 (27%)
Pkinase_Tyr 741..999 CDD:285015 78/280 (28%)
SAM_1 1033..1092 CDD:278937 3/15 (20%)
SAM 1039..1092 CDD:197735 2/9 (22%)
AT1G51830NP_001323323.1 Malectin_like <17..164 CDD:403886 19/133 (14%)
PLN00113 206..>298 CDD:215061 19/96 (20%)
leucine-rich repeat 225..245 CDD:275380 4/19 (21%)
leucine-rich repeat 246..269 CDD:275380 5/23 (22%)
leucine-rich repeat 270..294 CDD:275380 4/27 (15%)
STKc_IRAK 399..664 CDD:270968 79/283 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.