DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eph and BAK1

DIOPT Version :9

Sequence 1:NP_524625.3 Gene:Eph / 43803 FlyBaseID:FBgn0025936 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_001190904.1 Gene:BAK1 / 829480 AraportID:AT4G33430 Length:662 Species:Arabidopsis thaliana


Alignment Length:707 Identity:146/707 - (20%)
Similarity:269/707 - (38%) Gaps:177/707 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 MPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNICSPNVVYN 445
            :||:        ..|:.|  ...::..|..|:.::.|:..||....:.::......:.:|...::
plant     7 IPCF--------FWLILV--LDLVLRVSGNAEGDALSALKNSLADPNKVLQSWDATLVTPCTWFH 61

  Fly   446 PSTDTFNE-TKITLTNLEPVTTYTVQIHAINSVSHINEFKRH---------SNESSLVAVSDIVF 500
            .:.::.|. |::.|.|........:|:..:.::.::..:..:         .|.:.||:: |:..
plant    62 VTCNSDNSVTRVDLGNANLSGQLVMQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSL-DLYL 125

  Fly   501 SNTSLLNIPLDLNEVKTGQAEIVFTTESV----------LLSTVFNLRILAITNKDADLEWDKPV 555
            :|.| ..||..|..:|    ::.|.::.|          |...||:.|:      ...:.|...:
plant   126 NNLS-GPIPSTLGRLK----KLRFLSQKVVSPNRCYVILLDEKVFSWRL------GCCIIWSILI 179

  Fly   556 QSDFPLEFYEVRWFPKVELDAI----NKSALN-------TKETKAHIVGLLENTEYGFQVRCKTN 609
            .|           |.|...::|    |.::|:       |......::.|..|...|   ....|
plant   180 MS-----------FRKRNQNSILVRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTG---DIPVN 230

  Fly   610 NGFGSYSNMIYAQTLQS---------VGSVYDDSVQIRFIAGAIVTGV-----LFLVIFIIATVY 660
            ..|..::.:.:|.|..:         :............|.|||..||     |...:..||..:
plant   231 GSFSLFTPISFANTKLTPLPASPPPPISPTPPSPAGSNRITGAIAGGVAAGAALLFAVPAIALAW 295

  Fly   661 FMRSKHQDDLDKKSTNHLPLPLDYASNEVNSMDTTPIVKKLHLNVTTPLFGNSRSYVDPHTYEDP 725
            :.|.|.||                                              .:.|....|||
plant   296 WRRKKPQD----------------------------------------------HFFDVPAEEDP 314

  Fly   726 NQAIREFAR------EIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEK 784
            ...:.:..|      ::.::..:.:.|:|.|.||.|.:|||      .....||:|.||...::.
plant   315 EVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRL------ADGTLVAVKRLKEERTQG 373

  Fly   785 ARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLR--------VNDGKFQ 841
            ....|.||..::....|.|::.|:|........:::..||.|||:.:.||        ::..|.|
plant   374 GELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQ 438

  Fly   842 TLQLIVMLRGIASGMSYL---SDMNYVHRDLAARNVLVNAQLICKIADFGLSREIENASDAYTTR 903
            .:.|     |.|.|::||   .|...:|||:.|.|:|::.:....:.||||:: :.:..|.:.|.
plant   439 RIAL-----GSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAK-LMDYKDTHVTT 497

  Fly   904 GGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPY--WNWSNQ------DVIKSIEK 960
            ..:..:...|||.::..|.:..:||:.|||:|.|::: |:|.:  ...:|.      |.:|.:.|
plant   498 AVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELIT-GQRAFDLARLANDDDVMLLDWVKGLLK 561

  Fly   961 GYRLPAPMDCP----------EALYQLMLDCWQKQRTHRPTFASIVSTL--DNLARQ 1005
            ..:|.|.:|..          |.|.|:.|.|.|.....||..:.:|..|  |.||.:
plant   562 EKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAER 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphNP_524625.3 EphR_LBD 85..260 CDD:198439
FN3 387..476 CDD:238020 13/89 (15%)
FN3 536..623 CDD:238020 15/97 (15%)
EphA2_TM 644..736 CDD:291255 15/102 (15%)
PTKc_EphR 736..1002 CDD:270629 80/296 (27%)
Pkinase_Tyr 741..999 CDD:285015 78/286 (27%)
SAM_1 1033..1092 CDD:278937
SAM 1039..1092 CDD:197735
BAK1NP_001190904.1 LRRNT_2 26..65 CDD:285463 5/38 (13%)
leucine-rich repeat 94..117 CDD:275380 1/22 (5%)
leucine-rich repeat 118..141 CDD:275380 9/28 (32%)
leucine-rich repeat 142..187 CDD:275380 10/61 (16%)
leucine-rich repeat 188..211 CDD:275380 4/22 (18%)
TyrKc 337..610 CDD:197581 78/285 (27%)
STK_BAK1_like 342..613 CDD:271134 78/283 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.