DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eph and LOC572450

DIOPT Version :9

Sequence 1:NP_524625.3 Gene:Eph / 43803 FlyBaseID:FBgn0025936 Length:1096 Species:Drosophila melanogaster
Sequence 2:XP_701258.6 Gene:LOC572450 / 572450 -ID:- Length:272 Species:Danio rerio


Alignment Length:277 Identity:103/277 - (37%)
Similarity:156/277 - (56%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 TILLIIISIHFKLAHADQVVLLDTTR-EATLEWTRYPYGPQAQTPGWVEESFTD-FVKGINWRSY 129
            ::|.|::......:.|::||||::.. :|.|.||.||      :.||.|.|..| ..|.|  |:|
Zfish     9 SLLWILLFNRTPESRAEEVVLLNSKESQAELGWTSYP------SNGWEEISGVDEKYKPI--RTY 65

  Fly   130 VVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPGNALSCKETFSLLFYEFD----A 190
            .||:|...:.||||.:.:|.|....|::||:|||:|||:..||.:.||||||:||:.|.|    .
Zfish    66 QVCNVMEPSQNNWLQTGWIWRQGGQRIFIELQFTLRDCNSIPGVSGSCKETFNLLYAESDWDLGR 130

  Fly   191 ATREPPPWQTDSYRLIARIAAGEGRFNQNS----DVDINTEVKSIA-VNKKGVYFAFRDQGACIS 250
            .:||      |.|..|..|||.|. |.|..    .:.:||||:.|. :|:||.:.||:|.|||::
Zfish   131 VSRE------DRYSKIDTIAADES-FTQGDLGERKMKLNTEVREIGHLNRKGFHLAFQDVGACVA 188

  Fly   251 VLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNAEPYET---PTYLCKGDGKWTI 312
            :::|:|||..|.:..:|.|.|.:|......:.:.:..|.||:|:| .:|   |...|..:|:|.:
Zfish   189 LVSVRVYYKRCLSTVQNLAVFPDTVAEAAFSTLVEVRGACVNNSE-VDTDSPPRMHCSAEGEWLV 252

  Fly   313 LTGGCRCKAGYEPNYTN 329
            ..|.|.|.||||..:::
Zfish   253 PIGKCSCSAGYEEGHSS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphNP_524625.3 EphR_LBD 85..260 CDD:198439 78/185 (42%)
FN3 387..476 CDD:238020
FN3 536..623 CDD:238020
EphA2_TM 644..736 CDD:291255
PTKc_EphR 736..1002 CDD:270629
Pkinase_Tyr 741..999 CDD:285015
SAM_1 1033..1092 CDD:278937
SAM 1039..1092 CDD:197735
LOC572450XP_701258.6 EphR_LBD_A10 26..198 CDD:198455 78/186 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5332
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D397694at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.