DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eph and Alk

DIOPT Version :9

Sequence 1:NP_524625.3 Gene:Eph / 43803 FlyBaseID:FBgn0025936 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster


Alignment Length:434 Identity:126/434 - (29%)
Similarity:215/434 - (49%) Gaps:42/434 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 EYGFQVRCKTNNGFG-SYSNMIYAQTLQSVGSVYDDSVQIRFIAGAIVTGVLFLVIFIIATVYFM 662
            |:..:|||...:|:. ...|....:..:..|     ....:::...::..:..|.|.|.|.::.:
  Fly  1068 EFRSKVRCICPDGWSLKRDNHTACEIREEAG-----KSSFQYLVSILMISLAVLFICIAALIFML 1127

  Fly   663 RSKHQDDLDKKSTNHLPLPLDYASNEV-NSMDTTPIVKKLHLNVTTPLFGNS---RSYVDPHTYE 723
            .:::|.....|..:.:.:..|.....: |::|.:      :||...|.:|..   ..::|.::..
  Fly  1128 YNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDS------NLNNFNPNYGCDGILNGHIDVNSLP 1186

  Fly   724 DPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCD 788
               |..|:..:.::|        :|.|.||:|.....:.......::.||:|||:.....:...|
  Fly  1187 ---QVARDSLQLVNA--------LGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKEED 1240

  Fly   789 FLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVM----- 848
            ||.||:||.:|:|||:::|.||.....|..|:.|.:..|.|..|||.|....:...|:.|     
  Fly  1241 FLKEAAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLF 1305

  Fly   849 -LRGIASGMSYLSDMNYVHRDLAARNVLVNAQ---LICKIADFGLSREIENASDAYTTRGGK--I 907
             ...:|.|..|:....::|||:||||.|::::   .:.||||||:||:|..:.  |..:|||  :
  Fly  1306 CALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSD--YYRKGGKAML 1368

  Fly   908 PVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPE 972
            |::|..|||.....|||.:||||:|::||||.|.|..||....|..|::.:.:|.||.:|.:||.
  Fly  1369 PIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPV 1433

  Fly   973 ALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSP 1016
            ::|::|.|||......||||.:::..| ....|..|::.. |.|
  Fly  1434 SIYKVMADCWNPTPEDRPTFITLLEHL-TACTQDASIMNA-PLP 1475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphNP_524625.3 EphR_LBD 85..260 CDD:198439
FN3 387..476 CDD:238020
FN3 536..623 CDD:238020 6/24 (25%)
EphA2_TM 644..736 CDD:291255 16/95 (17%)
PTKc_EphR 736..1002 CDD:270629 99/276 (36%)
Pkinase_Tyr 741..999 CDD:285015 97/268 (36%)
SAM_1 1033..1092 CDD:278937
SAM 1039..1092 CDD:197735
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 101/289 (35%)
TyrKc 1193..1460 CDD:197581 98/276 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455342
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.