DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eph and Ret

DIOPT Version :9

Sequence 1:NP_524625.3 Gene:Eph / 43803 FlyBaseID:FBgn0025936 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster


Alignment Length:387 Identity:124/387 - (32%)
Similarity:189/387 - (48%) Gaps:68/387 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   644 IVTGVLFLVIFIIATVYFMRSKHQDDLDKKS---TNHLPLPL----DYASNEVNSMDTTPIVKKL 701
            ::|..|..|:.::..:...|...|..|.|:|   ::...||.    |:|                
  Fly   699 VITCPLLFVLLLLCLLIAQRKMLQRRLGKQSMTTSSKQALPESGGGDFA---------------- 747

  Fly   702 HLNVTTPLFGNSRSYVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNF 766
                ..||....|.        :...|..||.||    .:.::.::|.||||.|.:|       |
  Fly   748 ----LMPLQSGFRF--------ESGDAKWEFPRE----KLQLDTVLGEGEFGQVLKG-------F 789

  Fly   767 VQDI-------DVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYM 824
            ..:|       .||:|.||.||:.......|:|..::.:..|||||.|.|..|.|...::|.||.
  Fly   790 ATEIAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLLQEVSHPNVIKLLGACTSSEAPLLIIEYA 854

  Fly   825 ENGSLDTFLRVN-----------DG--KFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLV 876
            ..|||.::||::           ||  ......::.....|..||:|||::..|||||||||||:
  Fly   855 RYGSLRSYLRLSRKIECAGVDFADGVEPVNVKMVLTFAWQICKGMAYLSELKLVHRDLAARNVLL 919

  Fly   877 NAQLICKIADFGLSREIENASDAYTTRG-GKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMS 940
            ....||||:||||:|::.. .|||..|. .::||:|.|||::|...:||.|||||:||:.||:::
  Fly   920 ADGKICKISDFGLTRDVYE-DDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELIT 983

  Fly   941 YGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNL 1002
            .|..||...:.|::...::.|||:..|.:|.||:|.::..||..:...||:|..:.|..:.|
  Fly   984 LGASPYPGIAPQNLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASEFEKL 1045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphNP_524625.3 EphR_LBD 85..260 CDD:198439
FN3 387..476 CDD:238020
FN3 536..623 CDD:238020
EphA2_TM 644..736 CDD:291255 19/98 (19%)
PTKc_EphR 736..1002 CDD:270629 103/286 (36%)
Pkinase_Tyr 741..999 CDD:285015 103/278 (37%)
SAM_1 1033..1092 CDD:278937
SAM 1039..1092 CDD:197735
RetNP_477044.1 PKc_like 770..1049 CDD:304357 104/284 (37%)
TyrKc 771..1042 CDD:197581 103/278 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455298
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.