DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17698 and MYLK2

DIOPT Version :9

Sequence 1:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_149109.1 Gene:MYLK2 / 85366 HGNCID:16243 Length:596 Species:Homo sapiens


Alignment Length:373 Identity:78/373 - (20%)
Similarity:151/373 - (40%) Gaps:80/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMRRGPRKATSPLDR--VYREIAVLKK 349
            |.:|.|.:|.|.....:......|.|::.|:                 :|.|:  |..||.|:.:
Human   289 EALGGGKFGAVCTCMEKATGLKLAAKVIKKQ-----------------TPKDKEMVLLEIEVMNQ 336

  Fly   350 LDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFRESLLGLEYYTMLS 414
            |:|.|:::|...::.|.|..|:|  |.::.||:.                  |.::..:|:....
Human   337 LNHRNLIQLYAAIETPHEIVLFM--EYIEGGELF------------------ERIVDEDYHLTEV 381

  Fly   415 SSAISLKRIF--VYTVHHQKIIHADIKPGNLL-LTEFGH-VKIADLGVCNEFLGDDATISNGSTA 475
            .:.:.:::|.  :..:|..:::|.|:||.|:| :...|| |||.|.|:...:..::....|   .
Human   382 DTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVN---F 443

  Fly   476 GTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPEN- 539
            |||.|.:||.:   ..:......|:|::|...|.|:.|..|||.|........:...:..|.|. 
Human   444 GTPEFLSPEVV---NYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSGNWYFDEET 505

  Fly   540 -HKVTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLPTEEENCCLVQVDDEDIDSVVR 603
             ..|::..|..:..::.|:...|:...|.....|:.:     |..:.:.|               
Human   506 FEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNN-----LAEKAKRC--------------- 550

  Fly   604 SIPKLDTLILIKTMLKKHSFGNPFVKGCSGTSSSLAGCSRIERFIRAG 651
             ..:|.:.||:|..|.|..:...|:        :::..:|.::...:|
Human   551 -NRRLKSQILLKKYLMKRRWKKNFI--------AVSAANRFKKISSSG 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 66/293 (23%)
STKc_CAMKK 288..574 CDD:271020 66/293 (23%)
MYLK2NP_149109.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..224
STKc_MLCK2 280..540 CDD:271092 66/293 (23%)
Calmodulin-binding. /evidence=ECO:0000250 574..586 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.