DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17698 and stk11

DIOPT Version :10

Sequence 1:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001016533.1 Gene:stk11 / 549287 XenbaseID:XB-GENE-955279 Length:432 Species:Xenopus tropicalis


Alignment Length:124 Identity:28/124 - (22%)
Similarity:48/124 - (38%) Gaps:44/124 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NSGKIPVPKIELASMD-FTVQNITMTRLNAKW------DLSIRIPDDLPG-----KYICLQGDLE 85
            |||.:|       |:| |:..::|:...|:|.      ....:.|:.:|.     |.|.:..|  
 Frog   891 NSGMVP-------SLDAFSEFHLTVLAYNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKD-- 946

  Fly    86 ASLLYKNVTLATSSPQKYYNLKYFNPQLLKISANVSEVDIGGLIGKNIINDVKERKEVH 144
                  ..||:...|:             |::.|::    |.|:...||||..|..|::
 Frog   947 ------TATLSWGLPK-------------KLNGNLT----GYLLQYQIINDTYEIGELN 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17698NP_001036633.2 STKc_CAMKK 288..574 CDD:271020
stk11NP_001016533.1 STKc_LKB1 58..312 CDD:271021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.