DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17698 and sff

DIOPT Version :9

Sequence 1:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster


Alignment Length:332 Identity:103/332 - (31%)
Similarity:167/332 - (50%) Gaps:49/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 YRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMRRGPRKATSPLDRVYREIAVL 347
            |||.:.:|:|..|||||..........|:||:::::|             :.|.|.:|.||||::
  Fly    18 YRLEKTLGKGQTGLVKLGVHCVIGKKVAIKIINREKL-------------SESVLMKVEREIAIM 69

  Fly   348 KKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVL-RIPTDNPLSEKRAWSIFRESLLGLEYYT 411
            |.:|||:|:.|.:|.::  :..||::.|.|..||:. .:.....|:.|.|...||:.:..|::  
  Fly    70 KLIDHPHVLGLSDVYEN--KKYLYLILEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDF-- 130

  Fly   412 MLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAG 476
                            .|...|.|.|:||.||||.|..::||||.|:.:.   ..|.....::.|
  Fly   131 ----------------CHSHSICHRDLKPENLLLDEKNNIKIADFGMASL---QPAGSMLETSCG 176

  Fly   477 TPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPENHK 541
            :|.:..|| :|.|: :|.||.||||:.|..||:|:.|.:||..|::..|.||:|:.....|  |.
  Fly   177 SPHYACPE-VIRGE-KYDGRKADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIP--HF 237

  Fly   542 VTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLPTEEENCCLVQVD--------DEDI 598
            |..:.:|.:..|:|.||.:|:|:.::....|||:.|...|..|.....:||..        |.|:
  Fly   238 VPPDCQSLLRGMIEVNPDRRLTLAEINRHPWVTAGGKGELELELPMMEVVQTHVIPTATAVDPDV 302

  Fly   599 DSVVRSI 605
            .:.:.|:
  Fly   303 LNAICSL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 92/290 (32%)
STKc_CAMKK 288..574 CDD:271020 90/286 (31%)
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 92/290 (32%)
S_TKc 18..269 CDD:214567 92/290 (32%)
UBA_BRSK 298..350 CDD:270525 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.