DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17698 and CG4629

DIOPT Version :9

Sequence 1:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster


Alignment Length:366 Identity:101/366 - (27%)
Similarity:157/366 - (42%) Gaps:72/366 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 PPQHNTASKPQILYETRPIYPNVPYSPYSTPFS-SPRSSRRKPAFRESRRISIDKSGSFLQLNQY 283
            ||...|.:.|..:.:..|  |..||...:.... .||.......   .|||.:           |
  Fly    18 PPPLTTTTTPLTICQPPP--PTPPYQRLTKALQCDPRCGHEVTI---GRRIGL-----------Y 66

  Fly   284 RLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMRRGPRKATSPLDRVYREIAVLK 348
            |....||:|::..||||..:......|:|::.    |.:|||..:..|..:|       |||.|:
  Fly    67 RFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVD----LDRAGLDAKALRMLSS-------EIATLE 120

  Fly   349 KLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVL-RIPTDNPLSEKRAWSIFRESLLGLEYYTM 412
            .:.|||:::|.||::  ....:|:|.|.::.||:. .|....||.|..|..:.::.||.:::   
  Fly   121 CVHHPNILRLFEVVE--TLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKH--- 180

  Fly   413 LSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGST--- 474
                           :|....:|.|||..|:||.....:|:||.|...:.:       ||:.   
  Fly   181 ---------------MHSLGYVHRDIKAENVLLLSEDRLKLADFGFSTQLI-------NGANQKL 223

  Fly   475 ---AGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKF 536
               .|:|.:.|||..  ..:.|.|...||||||..||.::.||:||.|.::|.|...|.:.....
  Fly   224 DTFCGSPPYAAPELF--SDDHYIGAPVDVWALGILLYFMVVGNMPFRAPTIPGLKAAILKGDYLL 286

  Fly   537 PENHKVTENLKSC---IVQMLEKNPTQRITIPQLKTSKWVT 574
            |....:     .|   |.::|...|.||.||..:..|::||
  Fly   287 PGQLSL-----PCIRLIQRILIHIPAQRPTIDDMLNSQFVT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 86/299 (29%)
STKc_CAMKK 288..574 CDD:271020 84/295 (28%)
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 87/313 (28%)
S_TKc 66..321 CDD:214567 86/299 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.