DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17698 and Sik2

DIOPT Version :9

Sequence 1:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_569972.1 Gene:Sik2 / 31170 FlyBaseID:FBgn0025625 Length:1398 Species:Drosophila melanogaster


Alignment Length:474 Identity:119/474 - (25%)
Similarity:207/474 - (43%) Gaps:97/474 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 STPFSSPRSSRRKPAFRESRRISIDKSG----SFLQLNQ------YRLMEQIGQGSYGLVKLAYS 302
            |||..||.||            ::...|    ..|:|.:      |.:...||:|::.:||||..
  Fly   108 STPGPSPTSS------------AVGAGGISGKDLLKLKEPMRVGFYDIERTIGKGNFAVVKLARH 160

  Fly   303 EEDSTHYAMKILSKKRLLRQAGLMRRGPRKATSPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLE 367
            .......|:||:.|.:|             ..:.|.:||||:.::|:|.||:::||.:|::  .:
  Fly   161 RITKNEVAIKIIDKSQL-------------DQTNLQKVYREVEIMKRLKHPHIIKLYQVME--TK 210

  Fly   368 DSLYMVFELVKQGEVL-RIPTDNPLSEKRAWSIFRESLLGLEYYTMLSSSAISLKRIFVYTVHHQ 431
            :.:|:|.|...|||:. .|.....:||..|...|.:.:..:||                  .|.:
  Fly   211 NMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVEY------------------CHKK 257

  Fly   432 KIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPGQNEYCGR 496
            .|:|.|:|..||||....::||||.|..|.|...:..   .:..|:|.:.||| :..|: :|.|.
  Fly   258 GIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELL---ATWCGSPPYAAPE-VFEGK-QYTGP 317

  Fly   497 AADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPENHKVTENLKSCIVQMLEKNPTQR 561
            ..|:|:||..||.|:.|.:||...::..|.:::.....:.|  ..::...:..|.:||...||:|
  Fly   318 EIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIP--FFMSSECEHLIRRMLVLEPTRR 380

  Fly   562 ITIPQLKTSKWVTSD-------GDYPLPTEEENCCLVQVDDEDIDSVVRSIPKLDTLILIKT--M 617
            .||.|:|..:|:..:       ..|.|..|.      |...|..:.::|.:.:...:...||  .
  Fly   381 YTIDQIKRHRWMCPELLEHVLIAKYNLGAER------QTSVEPSEDILRIMAEYVGIGSDKTRAS 439

  Fly   618 LKKHSFGNPFV-------------KGCSGT-SSSLAGCSRIERFIRAGRSNSAPGSYHMSTARQP 668
            |||:::.:...             :..:|. :|:||..:...|.|.:.|::..|   ....::|.
  Fly   440 LKKNTYDHVAAIYLLLQDRVSHKKEQSNGLGASALASSTSASRMIYSSRNDHQP---TQQQSQQQ 501

  Fly   669 SSDTLLPSLMEHCSTQCNE 687
            |......|::  ...||::
  Fly   502 SKTISTSSIL--AKDQCHK 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 84/290 (29%)
STKc_CAMKK 288..574 CDD:271020 84/286 (29%)
Sik2NP_569972.1 STKc_SIK 140..392 CDD:270973 84/291 (29%)
S_TKc 141..392 CDD:214567 84/290 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.