DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17698 and CAMKK2

DIOPT Version :9

Sequence 1:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_016874183.1 Gene:CAMKK2 / 10645 HGNCID:1470 Length:606 Species:Homo sapiens


Alignment Length:453 Identity:220/453 - (48%)
Similarity:287/453 - (63%) Gaps:68/453 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 RPIYPNVPYSPYSTPFSSPRSSRRKPAFRESRRISIDKSGSFLQLNQYRLMEQIG---------- 290
            |.|.|::||||.|:|.||||..||...  ||..:||......:|||||.|.::||          
Human   120 RCICPSLPYSPVSSPQSSPRLPRRPTV--ESHHVSITGMQDCVQLNQYTLKDEIGKLMGGIITMV 182

  Fly   291 --------QGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMRRGPRKAT-----------SP 336
                    |||||:|||||:|.|:|:||||:||||:|:||||..||.|.:.|           .|
Human   183 KTPNASRKQGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGP 247

  Fly   337 LDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFR 401
            :::||:|||:|||||||||||||||||||.||.||||||||.||.|:.:||..||||.:|...|:
Human   248 IEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQ 312

  Fly   402 ESLLGLEYYTMLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDD 466
            :.:.|:||                  :|:|||||.||||.|||:.|.||:||||.||.|||.|.|
Human   313 DLIKGIEY------------------LHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSD 359

  Fly   467 ATISNGSTAGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQ 531
            |.:||  |.|||||.|||:|...:..:.|:|.||||:|.|||..:||..||:.:.:..|:.|||.
Human   360 ALLSN--TVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKS 422

  Fly   532 DSVKFPENHKVTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLPTEEENCCLVQVDDE 596
            .:::||:...:.|:||..|.:||:|||..||.:|::|...|||..|..|||:|:|||.||:|.:|
Human   423 QALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEE 487

  Fly   597 DIDSVVRSIPKLDTLILIKTMLKKHSFGNPFVKGCSGTSSSLAGCSRIERFIRAGRSNSAPGS 659
            ::::.|:.||.|.|:||:|||::|.||||||           .|..|.|      ||.||||:
Human   488 EVENSVKHIPSLATVILVKTMIRKRSFGNPF-----------EGSRREE------RSLSAPGN 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 156/318 (49%)
STKc_CAMKK 288..574 CDD:271020 155/314 (49%)
CAMKK2XP_016874183.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I4022
eggNOG 1 0.900 - - E1_KOG0585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 410 1.000 Inparanoid score I1873
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D856506at2759
OrthoFinder 1 1.000 - - FOG0001468
OrthoInspector 1 1.000 - - otm42004
orthoMCL 1 0.900 - - OOG6_100881
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1033
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.