DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34116 and CG11560

DIOPT Version :9

Sequence 1:NP_001036616.1 Gene:CG34116 / 4379912 FlyBaseID:FBgn0083952 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001303392.1 Gene:CG11560 / 39376 FlyBaseID:FBgn0036249 Length:307 Species:Drosophila melanogaster


Alignment Length:287 Identity:79/287 - (27%)
Similarity:122/287 - (42%) Gaps:99/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DIHEKIETGVYQLAVNDKSTRSTVWRVYRKIKKDDGSFLEHVLFCIGCRSIMSFTHKSTTNLRRH 71
            ||..||.:|.|:|.  .|:.||:||.|||:|.:.||:.|:...||:||:.:|..|..:|:|||.|
  Fly    27 DILMKINSGEYRLV--KKNKRSSVWNVYREIARPDGTKLKWRYFCMGCKRVMQSTGGTTSNLRIH 89

  Fly    72 RCHLQYLKKQAFCCYNSKGESND------------RKEET------------------------- 99
            :||::|:|:.......|....:|            :|.:|                         
  Fly    90 KCHVRYIKQNGHLTDGSHSYDHDPAPPASQPSPRVQKPKTRRPTSYSTQCEQFYEVTMDPETQYS 154

  Fly   100 --DQEHHEEHDDQQSM-----------------------SDELETKP-SPADVAAFV-------- 130
              |.|.....:::|::                       .:.|.|:| .|.|....|        
  Fly   155 DLDDEIEASLEEEQTIILQLKSKRELESSHSRPLLKLFSEENLSTEPEEPEDEIEIVEAEDQVPI 219

  Fly   131 ---------------GEAVSGGDSTAASARIPDIPEIALPLDASGVEESNVYAQTWSLEYRKLSE 180
                           |||:.           |...|.....||:.:.|:..||:.|:..:.:|:|
  Fly   220 ELDLCDIQHTTSDAGGEAIE-----------PKPTESVAQFDANAISEAESYAKAWAHAFLRLNE 273

  Fly   181 DQKFYAKKAIDEIFVLGRLRRLTLNTV 207
            |||||||::|||:.|||||.||:::||
  Fly   274 DQKFYAKRSIDELLVLGRLERLSISTV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34116NP_001036616.1 ZnF_BED 29..74 CDD:214746 20/44 (45%)
CG11560NP_001303392.1 ZnF_BED 48..93 CDD:214746 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.