DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34116 and ssp

DIOPT Version :9

Sequence 1:NP_001036616.1 Gene:CG34116 / 4379912 FlyBaseID:FBgn0083952 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster


Alignment Length:123 Identity:41/123 - (33%)
Similarity:62/123 - (50%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KFDD---IHEKIETGVYQLAVNDKSTRSTVWRVYRKIKKDDGSFLEHVLFCIGCRSIM-SFTHKS 64
            ||:.   |..|:..|.|:|.  .:..|.:||:|||:|.:.||:.:..:.||.||:.:| ||   :
  Fly    12 KFESNQVISAKVLRGEYRLL--RRKQRGSVWKVYREIVRTDGAIINGLYFCTGCKRVMRSF---N 71

  Fly    65 TTNLRRHRCHLQYLKKQAFCCYNSKGESNDRKEETDQEHHEEHDDQQSMSDELETKPS 122
            |:|||.|:||:.||:.:..|            ||...|.|     ...:.|.||.:.|
  Fly    72 TSNLRTHKCHVDYLRTEELC------------EEGIAEIH-----PPKLDDSLERRLS 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34116NP_001036616.1 ZnF_BED 29..74 CDD:214746 20/45 (44%)
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.