DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp and puc

DIOPT Version :9

Sequence 1:NP_001036572.1 Gene:Mkp / 4379907 FlyBaseID:FBgn0083992 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster


Alignment Length:203 Identity:60/203 - (29%)
Similarity:88/203 - (43%) Gaps:31/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELQRRMGNLRPTATVVTTPTGVRY--------IERSTSSVCVEDIAHCSQQLDPREYGFVVDTK 61
            |..:|...||.......||.:....        :.||.||..|.||                   
  Fly    84 YPNKRSRENLACDEVTSTTSSSTAMNGGGRTPALTRSCSSPAVYDI------------------- 129

  Fly    62 PDSVPACILSDFLYLGSQDAVSADNIIKYKITHILSVGIQTPEVEWPLPVNCTFLPCLDLPETNL 126
             ::.||..:...|.||  :...||:........:|:|..|:|.......:....:|..|.|..|:
  Fly   130 -ETHPASPVFPHLLLG--NGRDADDPSSVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNI 191

  Fly   127 MNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQP 191
            ..|...| .:|||||.::...||:||:||:|||.::.|.|:|:.:.:...:||.|||..||.|.|
  Fly   192 KQYFQEA-YDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISP 255

  Fly   192 NAGFIQQL 199
            |..|:.||
  Fly   256 NLNFMGQL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MkpNP_001036572.1 DSPc 66..200 CDD:238073 47/134 (35%)
pucNP_524273.1 DSPc 133..267 CDD:238073 47/134 (35%)
CDC14 <193..272 CDD:225297 32/72 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462491
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 1 0.900 - - E2759_KOG1716
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.