DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp and Styxl1

DIOPT Version :10

Sequence 1:NP_001036572.1 Gene:Mkp / 4379907 FlyBaseID:FBgn0083992 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001032877.2 Gene:Styxl1 / 360792 RGDID:1305845 Length:321 Species:Rattus norvegicus


Alignment Length:80 Identity:22/80 - (27%)
Similarity:39/80 - (48%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DLPETNLMNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKS 184
            |.|::.|.......| .|||...:.:..:||....|:|||.:.|:.:||...:...:.::..||.
  Rat   223 DTPDSILFPSFRHIS-HFIELHLKLRSVILVFSTRGISRSVAAVVAFLMHYNEETLKRSWAHVKK 286

  Fly   185 WRPCIQPNAGFIQQL 199
            .:..::||...:.||
  Rat   287 CKTNMRPNRALVAQL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MkpNP_001036572.1 DSP 66..201 CDD:350348 22/80 (28%)
Styxl1NP_001032877.2 RHOD 33..146 CDD:444705
PTP_DSP_cys 158..311 CDD:475123 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.