DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp and Styxl2

DIOPT Version :10

Sequence 1:NP_001036572.1 Gene:Mkp / 4379907 FlyBaseID:FBgn0083992 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001028516.2 Gene:Styxl2 / 240892 MGIID:2685055 Length:1138 Species:Mus musculus


Alignment Length:209 Identity:55/209 - (26%)
Similarity:91/209 - (43%) Gaps:37/209 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ILLYELQRRMGNLRPTATVVTTPTGVRYIERSTSSVCVEDIAHC---SQQLDPREYGFVVDTKPD 63
            :|:.:|..|:.......::..||             ||.|:...   .:|..||       .:.|
Mouse    91 LLVEDLYNRVREKMDDRSLFNTP-------------CVLDLQRALTQDRQEAPR-------NEVD 135

  Fly    64 SV-PACILSDFLYLGSQDAVSADNIIKYKITHILS----VGIQT-PEVEWPLPVNCTFLPCLDLP 122
            .| |...:::     ...||:...:.:..|||||:    .|:.| .|....|.:....:...|.|
Mouse   136 EVWPNVFIAE-----KSVAVNKGRLKRLGITHILNAAHGTGVYTGSEFYTGLEIQYLGVEVDDFP 195

  Fly   123 ETNLMNYILPASMEFIEDAHRS-QGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWR 186
            |.::..:...|: ||:::|..: :|.|||....|:|||..:|:.|||....|...:|...|:..|
Mouse   196 EVDISQHFRKAA-EFLDEALLTYRGKVLVSSEMGISRSAVLVVAYLMIFHSMAILEALMTVRRKR 259

  Fly   187 PCIQPNAGFIQQLK 200
             .|.||.||::||:
Mouse   260 -AIYPNDGFLKQLR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MkpNP_001036572.1 DSP 66..201 CDD:350348 42/141 (30%)
Styxl2NP_001028516.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PTP_DSP_cys 124..279 CDD:475123 47/163 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..336
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..473
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..515
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 552..575
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 592..618
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 660..694
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 761..800
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 850..1117
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.