DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp and Epm2a

DIOPT Version :10

Sequence 1:NP_001036572.1 Gene:Mkp / 4379907 FlyBaseID:FBgn0083992 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_034276.2 Gene:Epm2a / 13853 MGIID:1341085 Length:330 Species:Mus musculus


Alignment Length:138 Identity:36/138 - (26%)
Similarity:52/138 - (37%) Gaps:51/138 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IKYKITHILSV-GIQTPEVEWPLPVN---CTFLPCLDLPETNL-------MNYI----------- 130
            :..|:.|.|.| .:...:.||.:..|   |...|....|:|.:       ::||           
Mouse   175 VTIKLKHELGVTAVMNFQTEWDIIQNSSGCNRYPEPMTPDTMMKLYKEEGLSYIWMPTPDMSTEG 239

  Fly   131 ----LPASM----EFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYL---------------MQRRD 172
                ||.::    ..:|:.|    .|.|||||||.||.:.|.|:|               |.:|.
Mouse   240 RVQMLPQAVCLLHALLENGH----TVYVHCNAGVGRSTAAVCGWLHYVIGWNLRKVQYFIMAKRP 300

  Fly   173 MCY--EDA 178
            ..|  |||
Mouse   301 AVYIDEDA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MkpNP_001036572.1 DSP 66..201 CDD:350348 36/138 (26%)
Epm2aNP_034276.2 CBM20_laforin 1..128 CDD:99881
DSP_laforin-like 154..311 CDD:350375 36/138 (26%)
Glucan phosphatase signature motif CXAGXGR. /evidence=ECO:0000250|UniProtKB:O95278 265..271 5/5 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.