DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and Efna1

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_038959213.1 Gene:Efna1 / 94268 RGDID:620388 Length:302 Species:Rattus norvegicus


Alignment Length:168 Identity:50/168 - (29%)
Similarity:73/168 - (43%) Gaps:34/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 SPQPSPMRCKMMIPFPKFGATSFVTLLTLICMETVLLSTMSSCAKTFYMHWNTSNSIFRIDNTDH 235
            |..|.|.|       |:.....:..||.|.|        ..:.|....:.||:||..||.::...
  Rat    87 SSWPGPAR-------PRAMEFLWAPLLGLCC--------SLAAADRHIVFWNSSNPKFREEDYTV 136

  Fly   236 IIDVNKGNLAFEFDQVHIICPVYEPGTFENET-EKYIIYNVSKVEYETCRITNADPRVIAICDK- 298
            .:.:|        |.:.||||.||..:..:.. |:|.:|.|...||.||...:.| :|...|:: 
  Rat   137 HVQLN--------DYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKD-QVRWKCNQP 192

  Fly   299 -----PQKLMFFTITFRPFTPQPGGLEFLPGNDYYFIS 331
                 |:||   :..|:.|||...|.||..|:.||:||
  Rat   193 SAKHGPEKL---SEKFQRFTPFTLGKEFKEGHSYYYIS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 40/122 (33%)
PigN <557..>622 CDD:282796
Efna1XP_038959213.1 Ephrin-A_Ectodomain 116..244 CDD:259896 40/124 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.