Sequence 1: | NP_651927.1 | Gene: | Ephrin / 43799 | FlyBaseID: | FBgn0040324 | Length: | 652 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001337388.4 | Gene: | efna5a / 64256 | ZFINID: | ZDB-GENE-001128-1 | Length: | 227 | Species: | Danio rerio |
Alignment Length: | 231 | Identity: | 64/231 - (27%) |
---|---|---|---|
Similarity: | 97/231 - (41%) | Gaps: | 44/231 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 193 FVTLLTLICMETVLLSTMSS-CAKTFYMHWNTSNSIFRIDNTDHIIDV--NKGNLAFEFDQVHII 254
Fly 255 CPVYEPGTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQK---LMFFTITFRPFTPQP 316
Fly 317 GGLEFLPGNDYYFISTSSKDDLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALSNSKSVTDTGG 381
Fly 382 AINVN-IANNDE-----------SHVNSHGNNIAIG 405 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ephrin | NP_651927.1 | Ephrin_ectodomain | 217..358 | CDD:259861 | 44/145 (30%) |
PigN | <557..>622 | CDD:282796 | |||
efna5a | XP_001337388.4 | Ephrin-A_Ectodomain | 30..159 | CDD:259896 | 44/145 (30%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11304 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |