DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and efna5a

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_001337388.4 Gene:efna5a / 64256 ZFINID:ZDB-GENE-001128-1 Length:227 Species:Danio rerio


Alignment Length:231 Identity:64/231 - (27%)
Similarity:97/231 - (41%) Gaps:44/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 FVTLLTLICMETVLLSTMSS-CAKTFYMHWNTSNSIFRIDNTDHIIDV--NKGNLAFEFDQVHII 254
            |..|.:.:.|..:.|...|. .|..:.:.||.:|.  |....|:.|||  |        |.:.:.
Zfish     7 FYLLFSSLWMSVLGLDPASKVVADRYAVFWNRTNP--RFYRGDYHIDVCIN--------DYLDVY 61

  Fly   255 CPVYEPGTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQK---LMFFTITFRPFTPQP 316
            ||.|.....|..||:|::|.|:...|.:|..| |.......|::|..   .:.|:..|:.|||..
Zfish    62 CPHYMDTVPEERTERYVLYMVNYDGYSSCDHT-AKGFKRWECNRPHSPNGPLKFSEKFQLFTPFS 125

  Fly   317 GGLEFLPGNDYYFISTSSKDDLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALSNSKSVTDTGG 381
            .|.||.||.:||:||::..::      ||.|...:||..:    |.:|     ...|....|...
Zfish   126 LGFEFRPGREYYYISSTLAEN------GRRSCLRLKVFVR----PTNN-----CDKSHDRVDKFD 175

  Fly   382 AINVN-IANNDE-----------SHVNSHGNNIAIG 405
            ..::| |.||::           |.|||.|....:|
Zfish   176 DRSINSIENNNDGTSHESAEPSRSDVNSAGRVQTVG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 44/145 (30%)
PigN <557..>622 CDD:282796
efna5aXP_001337388.4 Ephrin-A_Ectodomain 30..159 CDD:259896 44/145 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.