DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and efnb3a

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_692670.2 Gene:efnb3a / 564234 ZFINID:ZDB-GENE-100316-1 Length:337 Species:Danio rerio


Alignment Length:271 Identity:72/271 - (26%)
Similarity:109/271 - (40%) Gaps:66/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 MHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPG--TFENETEKYIIYNVS-KVEY 280
            ::|||.|..|. |...:|:....|      |::.::||...|.  ....|.|.|.:|.|| :.:.
Zfish    42 VYWNTLNRRFG-DERGYILYPQIG------DRLDLVCPATSPAGPNSPPEYEFYKLYLVSTREQA 99

  Fly   281 ETCRITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTS--SKDDLYRRIG 343
            :.|.:..| |.::..||||...|.|||.|:.::|...|.||....|||.|:||  :|:.:....|
Zfish   100 DRCEVMGA-PNLLLTCDKPNSDMRFTIKFQEYSPNLWGHEFKNLRDYYIIATSDGTKEGIDSMRG 163

  Fly   344 GRCSTNNMKVVFKV-------------------CCAPE--------DNNKTTALSNSKSVTDTGG 381
            |.|.|..||:|.||                   ...|:        :.:::.|:|.|.....:||
Zfish   164 GVCVTRGMKLVLKVGQTAYGLPPKPKPDPGRPNSKIPDTESGSKGGETSESGAVSASNIALISGG 228

  Fly   382 A-------INVNIA-----NNDESHVNSHGNNIAIGT---NIGINGGQIIGGPQSAGIPINPLSG 431
            |       |.:.||     .....|..:|...:.:.:   ..|.:||...|.           ||
Zfish   229 AGGAFILLIAIVIAVVCYRRRKAKHSETHHPALTLSSLTPKRGSSGGTATGS-----------SG 282

  Fly   432 NNNINGIPTTI 442
            .||....|:.|
Zfish   283 GNNNGSEPSDI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 50/162 (31%)
PigN <557..>622 CDD:282796
efnb3aXP_692670.2 Cupredoxin 38..178 CDD:302766 49/143 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588211
Domainoid 1 1.000 87 1.000 Domainoid score I7950
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001210
OrthoInspector 1 1.000 - - otm25392
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.