DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and efna1b

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_957077.2 Gene:efna1b / 494151 ZFINID:ZDB-GENE-041007-5 Length:229 Species:Danio rerio


Alignment Length:178 Identity:55/178 - (30%)
Similarity:84/178 - (47%) Gaps:33/178 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LTLICMETVLLSTMSSCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPG 261
            |.|:|: .|.:|...:.|:...::||::|:.|..|  |:.:||...      |.:.||||.|..|
Zfish     4 LWLLCV-AVSVSAWYASAERHSVYWNSTNANFLWD--DYTVDVRIN------DYLDIICPHYAHG 59

  Fly   262 TF-ENETEKYIIYNVSKVEYETCRITNADPRVIAICDK------PQKLMFFTITFRPFTPQPGGL 319
            .. ..|.|:|::|.|...:||.|:..:.| ::...|.:      |:|   |:..|:.|||...|.
Zfish    60 EIASQEAERYVLYMVELEDYENCKPHSFD-QLRWECSRPFAPHAPEK---FSEKFQRFTPFTLGK 120

  Fly   320 EFLPGNDYYFIS----------TSSKDDLYRRIGGRCSTNNMKVVFKV 357
            ||..|..||:||          ...|.|:   :|...|.|..|:|.||
Zfish   121 EFRQGESYYYISKPLHHHGQECLRLKVDV---VGPHGSKNKKKMVEKV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 49/158 (31%)
PigN <557..>622 CDD:282796
efna1bNP_957077.2 Ephrin-A_Ectodomain 21..149 CDD:259896 41/139 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588223
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.