DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and efna1a

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_956891.1 Gene:efna1a / 393569 ZFINID:ZDB-GENE-040426-1135 Length:222 Species:Danio rerio


Alignment Length:268 Identity:65/268 - (24%)
Similarity:102/268 - (38%) Gaps:86/268 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LLTLICMETVLLSTMSSCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEP 260
            |:.|:.:...:.:..:| |:...:.||::||.||.|  |:.::|...      |.:.|:||.|..
Zfish     3 LVWLLYIAASICAVFAS-AERLTVFWNSTNSKFRWD--DYAVEVRLN------DYLDIVCPHYPL 58

  Fly   261 GTF-ENETEKYIIYNVSKVEYETCRITNAD-----------PRVIAICDKPQKLMFFTITFRPFT 313
            |.. ..:.|:|::|.|.:.:|:|||..:.|           |..      |:|   |:..|:.||
Zfish    59 GEVPSQDAERYVLYMVEREDYDTCRPQSYDQMRWECGHPFAPHA------PEK---FSEKFQRFT 114

  Fly   314 PQPGGLEFLPGNDYYFISTSSKDDLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALSNSKSVTD 378
            |...|.||..|..||:||    ..|:.. |..|.                               
Zfish   115 PFTLGKEFRQGESYYYIS----KPLHHH-GQECL------------------------------- 143

  Fly   379 TGGAINVNIANNDESHVNSHGNNIAIGTNIGINGGQIIGGPQSAGIPINPLSGNNNINGIP---- 439
               .:.|::..||    .|....:..||.:|..||        |..|.|.|..::.:..:|    
Zfish   144 ---RLRVDVIAND----GSQEARVGQGTKVGTGGG--------AHTPSNRLPADDPVVALPEVQK 193

  Fly   440 -TTINSNI 446
             |..||.|
Zfish   194 STRTNSAI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 43/152 (28%)
PigN <557..>622 CDD:282796
efna1aNP_956891.1 Ephrin-A_Ectodomain 21..149 CDD:259896 44/183 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588222
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.