DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and fam174c

DIOPT Version :10

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001295480.1 Gene:fam174c / 334310 ZFINID:ZDB-GENE-030131-6242 Length:120 Species:Danio rerio


Alignment Length:43 Identity:14/43 - (32%)
Similarity:20/43 - (46%) Gaps:4/43 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 DDHHHYN---KHPNEVVKNEELTYNSGAATSDGNI-FALWIWI 577
            ||:.|.:   |.|...:.|....|||..|:....| .||::.|
Zfish    20 DDNEHKSGSTKPPTSTISNSTEKYNSNNASDVAMINRALYVLI 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861
fam174cNP_001295480.1 DUF1180 <22..120 CDD:429067 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.