DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and Efnb2

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001100798.1 Gene:Efnb2 / 306636 RGDID:1309497 Length:336 Species:Rattus norvegicus


Alignment Length:290 Identity:78/290 - (26%)
Similarity:119/290 - (41%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LLTLICMETVLLSTMSSCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEP 260
            ||.::|...:..|.:..     .::||:|||.| :.....::....|      |::.||||..:.
  Rat    18 LLMVLCRTAISRSIVLE-----PIYWNSSNSKF-LPGQGLVLYPQIG------DKLDIICPKVDS 70

  Fly   261 GTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGN 325
            .|. .:.|.|.:|.|.|.:.:.|.|...:..::. |.:|.:.:.|||.|:.|:|...||||....
  Rat    71 KTV-GQYEYYKVYMVDKEQADRCTIKKENTPLLN-CARPDQDVKFTIKFQEFSPNLWGLEFQKNK 133

  Fly   326 DYYFISTS--SKDDLYRRIGGRCSTNNMKVVFKV-----CCAPEDNNKTT------ALSNSKSVT 377
            |||.||||  |.:.|..:.||.|.|..||::.||     ......||..|      |.:|.:|.|
  Rat   134 DYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNNDPTRRPELEAGTNGRSST 198

  Fly   378 DTGGAINVNIANNDESHVNSHGNNIAIGTNI----GINGGQII---------------------G 417
             |...:..|..::.:.:...|..|..:|:.:    ||..|.||                     .
  Rat   199 -TSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKH 262

  Fly   418 GPQ-----SAGIPINPLSGNNNINGIPTTI 442
            .||     |......|..|.||....|:.:
  Rat   263 SPQHTTTLSLSTLATPKRGGNNNGSEPSDV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 49/147 (33%)
PigN <557..>622 CDD:282796
Efnb2NP_001100798.1 Ephrin-B_Ectodomain 32..168 CDD:259897 48/149 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346769
Domainoid 1 1.000 77 1.000 Domainoid score I8639
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001210
OrthoInspector 1 1.000 - - otm44780
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.