DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and efnb2a

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_571098.1 Gene:efnb2a / 30219 ZFINID:ZDB-GENE-990415-67 Length:332 Species:Danio rerio


Alignment Length:203 Identity:60/203 - (29%)
Similarity:102/203 - (50%) Gaps:20/203 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 MHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETC 283
            ::|||:|:.| :.....::....|      |::.|:||..|.|:.|. .|.|.:|.|...:.::|
Zfish    30 IYWNTTNTKF-VPGQGLVLYPQIG------DKMDIVCPRVEGGSMEG-VEYYKLYMVPLEQLKSC 86

  Fly   284 RITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTS--SKDDLYRRIGGRC 346
            ::|.||..::. |.||.:.:.||:.|:.|:|...||||..|.|||.||||  :.:.|..:.||.|
Zfish    87 QVTKADTPLLN-CVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVC 150

  Fly   347 STNNMKVVFKVCCAPED--NNKTTALSNSKSVTDTGG-------AINVNIANNDESHVNSHGNNI 402
            .|.:||::.||...|.|  :.|....|......|.||       .:..:.:.:.|...:.:.::.
Zfish   151 KTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSS 215

  Fly   403 AIGTNIGI 410
            .||:.:.:
Zfish   216 VIGSEVAL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 49/140 (35%)
PigN <557..>622 CDD:282796
efnb2aNP_571098.1 Ephrin-B_Ectodomain 26..162 CDD:259897 49/140 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..212 8/49 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..285
PDZ-binding. /evidence=ECO:0000255 330..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588213
Domainoid 1 1.000 87 1.000 Domainoid score I7950
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001210
OrthoInspector 1 1.000 - - otm25392
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4391
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.